[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : guaA.2
DDBJ      :guaA         GMP synthase
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  281/915 : Eukaryota  13/199 : Viruses  0/175   --->[See Alignment]
c.23.16
:222 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   44->170 1o1yA PDBj 1e-16 36.3 %
:RPS:PDB   1->170 1bxrB PDBj 4e-17 15.2 %
:RPS:SCOP  40->221 2ghrA1  c.23.16.8 * 1e-20 19.7 %
:HMM:SCOP  1->209 2ghrA1 c.23.16.8 * 6.3e-41 34.1 %
:RPS:PFM   46->170 PF00117 * GATase 4e-07 36.2 %
:HMM:PFM   42->172 PF00117 * GATase 1.9e-20 27.6 127/192  
:BLT:SWISS 40->176 YFEJ_SALTY 1e-13 32.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99152.1 GT:GENE guaA.2 GT:PRODUCT GMP synthase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 370767..371435 GB:FROM 370767 GB:TO 371435 GB:DIRECTION + GB:GENE guaA GB:PRODUCT GMP synthase GB:NOTE COG0518 [F] GMP synthase - Glutamine amidotransferase domain glutamine-hydrolyzing GB:PROTEIN_ID ABD99152.1 GB:DB_XREF GI:90820513 GB:GENE:GENE guaA LENGTH 222 SQ:AASEQ MKITVLQHTPNEGLGMIRDYAHLHKHELYVYHPYQFGILPQANEIDFLIILGGPMSPNDDLDWIVQERKIIAELLARKKPIIGFCYGAQQIAKTLGYKVTKSPYKEVGWAKVYRQCDIKLELPDSFTAFHWHEEMFEVPQEAKLLFSSDLVKNQGFILGDNVVGLQFHFEQDEDSVREVALNDGNYALQNNALHQTPEDIIKHGVPKENKEILFKLLDYLLV GT:EXON 1|1-222:0| BL:SWS:NREP 1 BL:SWS:REP 40->176|YFEJ_SALTY|1e-13|32.1|137/239| BL:PDB:NREP 1 BL:PDB:REP 44->170|1o1yA|1e-16|36.3|124/223| RP:PDB:NREP 1 RP:PDB:REP 1->170|1bxrB|4e-17|15.2|165/379| RP:PFM:NREP 1 RP:PFM:REP 46->170|PF00117|4e-07|36.2|116/185|GATase| HM:PFM:NREP 1 HM:PFM:REP 42->172|PF00117|1.9e-20|27.6|127/192|GATase| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF00117|IPR000991| RP:SCP:NREP 1 RP:SCP:REP 40->221|2ghrA1|1e-20|19.7|178/269|c.23.16.8| HM:SCP:REP 1->209|2ghrA1|6.3e-41|34.1|205/0|c.23.16.8|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 369 OP:NHOMOORG 316 OP:PATTERN ------111111111--------1-11-1-1------------22--1--323-------------11 --1------------------1---------------11-1-------1---1----1--1-1---1-1--1111111----1-1111-----------------11------------------11111111111------------1----1-11--11---11-----1111-1111111------------------------------------------111111-1----1----------------1111111111111122-2--------------111---------------------------1-------1---------------11----------------1-1-----11----1-1-----1111122111--121--1----------1---2--1--132-22212212221112----1----1112-------------1-1-----------------------------1-11-1-----111-1111111--111111111111111--1111----2-1----1-12121--------111-111-1------1-----1112-11-1-------21------------------------22--1-1-1------111--11--1---1-11---1---------1----1-------------------------------111-2---11111111111111111-------------------------111111211-1-11---------------2222222---112222-1-----------11111111111-------------11----------------111111-----------------------------------------1-111--1 ----------1------------1--------------------11------------1---1------------------------1----------------------------------------------------------------------------------2--1------------331-1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 210 STR:RPRED 94.6 SQ:SECSTR GccEEEEEEEccccHHHHHHHHTTTEEEEEEETTccHHHHHTTcccEEEEcccccccTTcHHHHHHHTHHHHHHTTccccEEEETHHHHHHHHTTTcEEEEEEEEEEEEEEEEEETTTTEEEEEEEEEEEEEEEGGGccTTEEEEEEETccEEEEEEccccEEEEcccTTTTTcTTTEEcccHHTTcTTcccEEEETTccEEEEccccEE############ PSIPRED cEEEEEEccccccHHHHHHHHHHcccEEEEEEcccccccccHHcccEEEEccccccccccHHHHHHHHHHHHHHHHccccEEEEcHHHHHHHHHcccEEEEcccccEEEEEEEEcccccccccccEEEEEEcccEEEcccccEEEEEcccccEEEEEEcccEEEEEEcccccHHHHHHHHHHHHHHHHccccHHHcHHHHHHcccHHHHHHHHHHHHHHHcc //