[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : guaC
DDBJ      :guaC         GMP reductase
Swiss-Prot:GUAC_LACS1   RecName: Full=GMP reductase;         EC=1.7.1.7;AltName: Full=Guanosine 5'-monophosphate oxidoreductase;         Short=Guanosine monophosphate reductase;

Homologs  Archaea  40/68 : Bacteria  828/915 : Eukaryota  190/199 : Viruses  0/175   --->[See Alignment]
c.1.5
:325 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->319 1ypfA PDBj e-108 65.6 %
:RPS:PDB   4->314 2bznB PDBj 5e-45 30.0 %
:RPS:SCOP  1->319 1ak5A1  c.1.5.1 * 2e-72 26.5 %
:HMM:SCOP  1->315 1jr1A1 c.1.5.1 * 2.7e-95 42.6 %
:RPS:PFM   6->67,90->309 PF00478 * IMPDH 6e-45 43.6 %
:HMM:PFM   3->320 PF00478 * IMPDH 1.2e-103 43.6 314/351  
:BLT:SWISS 1->325 GUAC_LACS1 0.0 100.0 %
:PROS 164->176|PS00487|IMP_DH_GMP_RED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99947.1 GT:GENE guaC GT:PRODUCT GMP reductase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1172799..1173776 GB:FROM 1172799 GB:TO 1173776 GB:DIRECTION + GB:GENE guaC GB:PRODUCT GMP reductase GB:NOTE COG0516 [F] IMP dehydrogenase/GMP reductase GB:PROTEIN_ID ABD99947.1 GB:DB_XREF GI:90821308 GB:GENE:GENE guaC LENGTH 325 SQ:AASEQ MPVFDYEDIQLVPNKCIVKSRSEVNTKVKFGPMTFKIPVVPANMQTIIDENLAVWLAKNGYFYIMHRFYENERVDFVKNMHDKGLFASISVGVKPAEYDLIDELSQKNLVPEYITIDIAHGHSDTVINMIKHIKHKLPGVFVIAGNVGTPEAVRELENAGADATKVGIGPGKACITKLKTGFGTGGWQLAAIRACAKAASKPIVADGGIRNNGDIAKSIRFGASMCMIGSLFAGHDETPGDIIEKDGKKFKTYFGSASQYQKGEYKNVEGKKLLLPYKGKIADTLREMQEDLQSAISYAGGKELLALRKVDYVIVKNSIYNGDML GT:EXON 1|1-325:0| SW:ID GUAC_LACS1 SW:DE RecName: Full=GMP reductase; EC=1.7.1.7;AltName: Full=Guanosine 5'-monophosphate oxidoreductase; Short=Guanosine monophosphate reductase; SW:GN Name=guaC; OrderedLocusNames=LSL_1139; SW:KW Complete proteome; NADP; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->325|GUAC_LACS1|0.0|100.0|325/325| GO:SWS:NREP 2 GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| PROS 164->176|PS00487|IMP_DH_GMP_RED|PDOC00391| SEG 190->199|aairacakaa| BL:PDB:NREP 1 BL:PDB:REP 3->319|1ypfA|e-108|65.6|294/295| RP:PDB:NREP 1 RP:PDB:REP 4->314|2bznB|5e-45|30.0|310/317| RP:PFM:NREP 1 RP:PFM:REP 6->67,90->309|PF00478|6e-45|43.6|279/459|IMPDH| HM:PFM:NREP 1 HM:PFM:REP 3->320|PF00478|1.2e-103|43.6|314/351|IMPDH| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00478|IPR001093| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00478|IPR001093| RP:SCP:NREP 1 RP:SCP:REP 1->319|1ak5A1|2e-72|26.5|298/329|c.1.5.1| HM:SCP:REP 1->315|1jr1A1|2.7e-95|42.6|310/0|c.1.5.1|1/1|Inosine monophosphate dehydrogenase (IMPDH)| OP:NHOMO 1695 OP:NHOMOORG 1058 OP:PATTERN 11--------------11------2--112221111111111111111-----111111111111-11 111-211222212122222-2222222222222222222211212221121211222211222222222221111111--11-1111122111211---212111111111-------11-111-1111111111111111---111-1-11-1---11-111--1---11--1-------1-1111111211222222222222222221221222211122222222222112222222222222122222222222212222122222221122222222222211222222222222222222222222122111222211122111111111111111111111111111111111111111111111111111111111111111112122211111111111-11111111111111111111111111111111111111111111111111111121111111111---------------111111111111111111111111111111111111111111111111212222222222221111211111111111111211111111111111222111111222212111111111111111222222211111112221111111111111112111111211111-1111111-11122222222222222222-222222222222222222222222111222222222222222222222222112222222222221111111112222111111111111111111111111111111111111211111111111111111111112222222222222211111111111111111111111111111-1-1-1----2------------12------1-11111111111 11-1112-522-1111111-111111111-1111111111111111111111111111111111111111112-12344311111111-11111111111111212-12148666864334444453E4Jh9-86C3443644442433443394324424932222311323421111I1111121231211133432 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 324 STR:RPRED 99.7 SQ:SECSTR cccccGGGEEEccccccccccccEEEEcTTTcEEEEccEEEcccTTTccHHHHHHHGGGTcEEEccccccHHHHHHHHHcGGGGGGEEEEEcccHHHHHHHHHHHHHcTTccEEEEEcccTTcHHHHHHHHHHHHHcTTcEEEEEEEccHHHHHHHHHTTccEEEEcccccTTccHHHHHcccccHHHHHHHHHHHHHTTcEEEEEcccccHHHHHHHHHTTccEEEEcTTTTTcTTccccEEEETTEEEEEEEcTTcHHHHHHcccccccEEEEEccccHHHHHHHHHHHHHHHHHHHTcccGGGTTTTccEEcccccccccc# DISOP:02AL 261-265,324-326| PSIPRED ccccccHHEEEcccccccccHHHcccEEEEccEEEEEEEEEccccccccHHHHHHHHHcccEEEEEccccHHHHHHHccccccEEEEEEEEcccHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHHccccEEEEEEccccccccHHHccccccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHccccEEEEcHHHHccccccccEEEEccEEEEccccccHHHHHccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHcccccHHHHccccEEEEcccccccccc //