[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : holA
DDBJ      :holA         DNA polymerase III, delta subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  247/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.80.1c.37.1
:340 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   93->179 1eaqB PDBj 1e-04 4.6 %
:RPS:SCOP  4->142 1jqlB  c.37.1.20 * 2e-11 17.4 %
:RPS:SCOP  134->213 1sxjA2  c.37.1.20 * 6e-04 20.0 %
:RPS:SCOP  218->333 1jqjC1  a.80.1.1 * 8e-16 23.0 %
:HMM:SCOP  1->216 1jr3D2 c.37.1.20 * 1.4e-17 19.4 %
:HMM:SCOP  217->337 1jr3D1 a.80.1.1 * 2.6e-26 35.8 %
:RPS:PFM   72->194 PF06144 * DNA_pol3_delta 2e-13 35.1 %
:RPS:PFM   204->335 PF12169 * DNA_pol3_gamma3 2e-04 30.6 %
:HMM:PFM   19->193 PF06144 * DNA_pol3_delta 1.3e-41 32.9 170/172  
:HMM:PFM   216->276 PF12169 * DNA_pol3_gamma3 0.00025 18.0 61/143  
:BLT:SWISS 3->320 YQEN_BACSU 1e-63 38.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99491.1 GT:GENE holA GT:PRODUCT DNA polymerase III, delta subunit GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 730304..731326 GB:FROM 730304 GB:TO 731326 GB:DIRECTION + GB:GENE holA GB:PRODUCT DNA polymerase III, delta subunit GB:NOTE COG1466 [L] DNA polymerase III, delta subunit GB:PROTEIN_ID ABD99491.1 GB:DB_XREF GI:90820852 GB:GENE:GENE holA LENGTH 340 SQ:AASEQ MKVDELRKEIENNSLKNVYLVLGEDTYLNNKVKELFWNYIPESDREFNAAIYDMETTSIATAIADAISAPFFSEKRLVIITHPYFLTGDTKKHSIEQDVNELIGYLQNPSPDTLLVVLASYDKLDSRKKVVKELKSKAEIVDTSSLNESEIRQYLIKYCDGKKVIIEKRAIDRLIQLTNANFSKIMNELSKLIIATVDTKKITVSEVDGLVTKSLEQNVFDLVDFVRDKKIKEAFELYHELLEQKEEPIKINAILIGQFRLLLQVKILQKHSYDQGSIASTLKVHPFRVKLAMQNARKFSNNSLKSAYLGLAEIEEKLKTSSQNPELLFQLFLTKYAYKK GT:EXON 1|1-340:0| BL:SWS:NREP 1 BL:SWS:REP 3->320|YQEN_BACSU|1e-63|38.4|318/347| SEG 56->69|ttsiataiadaisa| RP:PDB:NREP 1 RP:PDB:REP 93->179|1eaqB|1e-04|4.6|87/122| RP:PFM:NREP 2 RP:PFM:REP 72->194|PF06144|2e-13|35.1|114/168|DNA_pol3_delta| RP:PFM:REP 204->335|PF12169|2e-04|30.6|121/136|DNA_pol3_gamma3| HM:PFM:NREP 2 HM:PFM:REP 19->193|PF06144|1.3e-41|32.9|170/172|DNA_pol3_delta| HM:PFM:REP 216->276|PF12169|0.00025|18.0|61/143|DNA_pol3_gamma3| GO:PFM:NREP 4 GO:PFM GO:0003677|"GO:DNA binding"|PF06144|IPR010372| GO:PFM GO:0003887|"GO:DNA-directed DNA polymerase activity"|PF06144|IPR010372| GO:PFM GO:0006260|"GO:DNA replication"|PF06144|IPR010372| GO:PFM GO:0009360|"GO:DNA polymerase III complex"|PF06144|IPR010372| RP:SCP:NREP 3 RP:SCP:REP 4->142|1jqlB|2e-11|17.4|132/140|c.37.1.20| RP:SCP:REP 134->213|1sxjA2|6e-04|20.0|80/249|c.37.1.20| RP:SCP:REP 218->333|1jqjC1|8e-16|23.0|113/117|a.80.1.1| HM:SCP:REP 1->216|1jr3D2|1.4e-17|19.4|206/211|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 217->337|1jr3D1|2.6e-26|35.8|120/127|a.80.1.1|1/1|DNA polymerase III clamp loader subunits, C-terminal domain| OP:NHOMO 253 OP:NHOMOORG 247 OP:PATTERN -------------------------------------------------------------------- 11-----1----------------------------------------------------------------------1-11-1--1111111111---11111111111-------------------------1111111111----111--111------------------1---1---------11111111111111111121111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111221211111111111111111111111111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------111111111------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-1---1--------1---111-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 160 STR:RPRED 47.1 SQ:SECSTR ############################################################################################EETTcccccccEEEEcccccTTcEEEEEEccccccccEEccEEEETTEEEccccEEccccTTccccEEEEEEcccccEEEEcccccEHTcHHHHHTHHHHHHHHHHHHHHHHHccc#ccHHHHH#######HHHHTcHHHHHHHHHHHHHHHHHTcccccHHHHHHHH################################################################################ DISOP:02AL 271-277,340-341| PSIPRED ccHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHHccccccccEEEEEEccHHHHHHHHHHHHccccccccEEEEEEcHHHccccccccccHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccc //