[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : holB
DDBJ      :holB         DNA polymerase III, delta' subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  904/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:330 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   24->176 1xxhB PDBj 1e-22 36.4 %
:RPS:PDB   21->67 3cf1B PDBj 1e-04 23.4 %
:RPS:PDB   60->168 3c58A PDBj 2e-17 8.3 %
:RPS:SCOP  9->176 1jr3A2  c.37.1.20 * 6e-39 32.9 %
:HMM:SCOP  3->206 1a5tA2 c.37.1.20 * 3.3e-46 28.4 %
:RPS:PFM   30->158 PF00004 * AAA 3e-04 31.8 %
:HMM:PFM   30->162 PF00004 * AAA 2.6e-07 29.1 110/130  
:BLT:SWISS 5->324 HOLB_BACSU 2e-62 37.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00031.1 GT:GENE holB GT:PRODUCT DNA polymerase III, delta' subunit GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1257561..1258553) GB:FROM 1257561 GB:TO 1258553 GB:DIRECTION - GB:GENE holB GB:PRODUCT DNA polymerase III, delta' subunit GB:NOTE COG0470 [L] ATPase involved in DNA replication GB:PROTEIN_ID ABE00031.1 GB:DB_XREF GI:90821392 GB:GENE:GENE holB LENGTH 330 SQ:AASEQ MKMSITERQPFLTKHFAKLIRENKLVHAYLLSGAEGTGKIELAKWIAKGIFCLNSQNGVPCLKCSECNRIENNNHPDVVTIMPDGLSIKVEQIRYLKSEFNKSGVESDRKVFIIQDAQKMSIGAANSLLKFLEEPSGNITAFLLTSEPQKLLPTIISRCQEVEMQQLTSGQLEQELISEGISEKNSHILANLAQSVVEAKKINDNENFNKILATVNNWYRKLLRKDLLSFVMIQSKIIGLIQNKEDQNLVLQVIILTVRDTVLERFGLTEEIVFKENIDFIQQNTAQIANSKLVNGLNLVVESNRKLASNISMQNMLETLTLNLFDCYFK GT:EXON 1|1-330:0| BL:SWS:NREP 1 BL:SWS:REP 5->324|HOLB_BACSU|2e-62|37.9|319/329| BL:PDB:NREP 1 BL:PDB:REP 24->176|1xxhB|1e-22|36.4|151/364| RP:PDB:NREP 2 RP:PDB:REP 21->67|3cf1B|1e-04|23.4|47/723| RP:PDB:REP 60->168|3c58A|2e-17|8.3|109/269| RP:PFM:NREP 1 RP:PFM:REP 30->158|PF00004|3e-04|31.8|110/123|AAA| HM:PFM:NREP 1 HM:PFM:REP 30->162|PF00004|2.6e-07|29.1|110/130|AAA| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF00004|IPR003959| RP:SCP:NREP 1 RP:SCP:REP 9->176|1jr3A2|6e-39|32.9|167/240|c.37.1.20| HM:SCP:REP 3->206|1a5tA2|3.3e-46|28.4|204/0|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 1568 OP:NHOMOORG 913 OP:PATTERN -------------------------------------------------------------------- 2221222222212222222-22222222222222222222212221222112222222112222222122212222112222222222111111111-122211112121111111111111112221121222112212222222235122222221111222122441222222222222221211222222222222232222242222222222222422222222222222222222222222222222222222222222222222222222222222222222222222222222222222212222222222222222222222233232221122222221122222222222222222221121221111222111111122-1111122222222222-11211111111-2222221221221222112122222222222222212222211111111111111111111111111222222212112222121111211111112111111111122221122222222222221222221221222222211122222222222112221222222222222122222111111111111111-111111111222222222222222222212222222222222-222222212221-222112222222212-2221222121222222221111212211-111111111111111222222222222222222222222222222222222222222222222222222222222222222222222222222222221111111112222222222222222221211222111122211111111111111111222222-21212211111211211111121111111212 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1----2--------------31-2-31--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 238 STR:RPRED 72.1 SQ:SECSTR #########TTHHHHHHHHHHTTccccEEEEEccTTccHHHHHHHHHHHHTcccccTTcHHHHHHHHHHHHTTccccEEEEcGGGcTTcHHHHHHHHTTccEEEEEEETTEEEEEETTTEEEcTTTcEEEEEcTTcEEEEEEccccEEEEEcTTcccEEEEEEGGGHHHHHHHHTTcccccTTccTTTcccccccGGGcHHHHHHHHHHHHHHHHHHHHHHTTcEEcccHHHHHHHHHHHHHTTccc################################################################################### PSIPRED ccHHHHHccHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHccccccEEEEccccccccHHHHHHHHHHHHHcHHHcccEEEEEEcHHHccHHHHHHHHHHHHcccccEEEEEEEccHHHccHHHHHcEEEEEcccccHHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccHHHccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcc //