[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ksgA
DDBJ      :ksgA         Dimethyladenosine transferase
Swiss-Prot:KSGA_LACS1   RecName: Full=Dimethyladenosine transferase;         EC=2.1.1.-;AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase;AltName: Full=16S rRNA dimethylase;AltName: Full=High level kasugamycin resistance protein ksgA;AltName: Full=Kasugamycin dimethyltransferase;

Homologs  Archaea  55/68 : Bacteria  908/915 : Eukaryota  188/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:296 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->288 3fycA PDBj 2e-39 42.1 %
:RPS:PDB   27->214 3bt7A PDBj 9e-18 10.5 %
:RPS:SCOP  31->294 1qyrA  c.66.1.24 * 4e-63 32.1 %
:HMM:SCOP  14->297 1i4wA_ c.66.1.24 * 6.4e-79 44.9 %
:RPS:PFM   26->286 PF00398 * RrnaAD 4e-56 51.2 %
:HMM:PFM   24->289 PF00398 * RrnaAD 7e-74 38.3 256/262  
:BLT:SWISS 1->296 KSGA_LACS1 e-166 100.0 %
:PROS 55->82|PS01131|RRNA_A_DIMETH

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99044.1 GT:GENE ksgA GT:PRODUCT Dimethyladenosine transferase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 283497..284387 GB:FROM 283497 GB:TO 284387 GB:DIRECTION + GB:GENE ksgA GB:PRODUCT Dimethyladenosine transferase GB:NOTE COG0030 [J] Dimethyladenosine transferase (rRNA methylation) GB:PROTEIN_ID ABD99044.1 GB:DB_XREF GI:90820405 GB:GENE:GENE ksgA LENGTH 296 SQ:AASEQ MANELPEIANPTRTRAIMETYGLTFKKSLGQNFLTDINILKNIVAAAEVSEEDNVIEIGPGIGALTEQLAKRANKVMALEIDDRLLPVLADTLSPYENVEVVHQDILKADLKALIAEHFEPGHKLKLVANLPYYITTPILMHLLDSGIEFETIVVMMQKEVAERLAANPGTKAYGSLSVAVQYEMDSEIAFIVPKTVFVPQPNVDSAIIVLNKKKVKPKEPQDEKHFKKLVKGSFMHRRKSLWNNLQSLYGKDPETKEKMLQALEVADIKQSIRAEKLTVADFINLSDALVKMGIN GT:EXON 1|1-296:0| SW:ID KSGA_LACS1 SW:DE RecName: Full=Dimethyladenosine transferase; EC=2.1.1.-;AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase;AltName: Full=16S rRNA dimethylase;AltName: Full=High level kasugamycin resistance protein ksgA;AltName: Full=Kasugamycin dimethyltransferase; SW:GN Name=ksgA; OrderedLocusNames=LSL_0229; SW:KW Antibiotic resistance; Complete proteome; Methyltransferase;RNA-binding; rRNA processing; S-adenosyl-L-methionine; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->296|KSGA_LACS1|e-166|100.0|296/296| GO:SWS:NREP 5 GO:SWS GO:0046677|"GO:response to antibiotic"|Antibiotic resistance| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0006364|"GO:rRNA processing"|rRNA processing| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 55->82|PS01131|RRNA_A_DIMETH|PDOC00871| BL:PDB:NREP 1 BL:PDB:REP 31->288|3fycA|2e-39|42.1|247/265| RP:PDB:NREP 1 RP:PDB:REP 27->214|3bt7A|9e-18|10.5|181/369| RP:PFM:NREP 1 RP:PFM:REP 26->286|PF00398|4e-56|51.2|248/256|RrnaAD| HM:PFM:NREP 1 HM:PFM:REP 24->289|PF00398|7e-74|38.3|256/262|RrnaAD| GO:PFM:NREP 3 GO:PFM GO:0000154|"GO:rRNA modification"|PF00398|IPR001737| GO:PFM GO:0000179|"GO:rRNA (adenine-N6,N6-)-dimethyltransferase activity"|PF00398|IPR001737| GO:PFM GO:0008649|"GO:rRNA methyltransferase activity"|PF00398|IPR001737| RP:SCP:NREP 1 RP:SCP:REP 31->294|1qyrA|4e-63|32.1|252/252|c.66.1.24| HM:SCP:REP 14->297|1i4wA_|6.4e-79|44.9|267/0|c.66.1.24|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 1327 OP:NHOMOORG 1151 OP:PATTERN --1111-1--------1111111111111111111111111111111111111111111111111--1 1111211111121211121-2111122222211111211111111112111111111111121111212111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122111111111112111111111123613111123331111421211111111111111111111111111111111111111422111111111111121111111111211111211111111111113111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 22-1221-411122111111111111111-1111111111111-1-111111111111-111111111111111111-1111111111-1211111111111122212-2432223-223212222121272-2222112312311221221232222211221221423142222122F2222222331322232223 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 292 STR:RPRED 98.6 SQ:SECSTR cccGGGcHHcHHHHHHcEEETHHHHHTccccccHHHHHHHHHHHHHHTTTcccEEEEEccTTcHHHHHHGGGccEEEEEcccHHHHHHHHHHHHHTTcccEEEEccccHHHGGGHHHHHHHHccccccTTGGGccGGGccEEEEEEcccTTcccHHHHHHHTTccEEEEEEccHHHHHHHHHHHHHHEEEEEEEEEcccTTccccEEEEEEEEcEEEEEEEEEEccccEEEEEEccccHHHHHHHHHHHTTcEEHTTcEEEEEccEETTEEccTTccccccEEEHHHHHHHH#### DISOP:02AL 1-6,8-8,296-297| PSIPRED ccccHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHccEEEEEEccHHHHHHHHHHHcccccEEEEEccEEEccHHHHHHHHccccccEEEEEEccccccHHHHHHHHHccccccEEEEEEEHHHHHHHHcccccccHHHHHHHHHHHEEEEEEEEEcHHHccccccccEEEEEEEEccccccccccHHHHHHHHHHHHccccHHHHHHHHHHcccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccc //