[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ktrA
DDBJ      :ktrA         Potassium uptake protein
Swiss-Prot:             

Homologs  Archaea  11/68 : Bacteria  364/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.2.1d.286.1
:212 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->140 2hmtA PDBj 2e-24 36.7 %
:RPS:PDB   48->210 2bkoA PDBj 2e-14 14.7 %
:RPS:SCOP  5->130 1id1A  c.2.1.9 * 2e-13 18.4 %
:RPS:SCOP  136->210 1vctA2  d.286.1.1 * 9e-14 22.7 %
:HMM:SCOP  3->136 1lsuA_ c.2.1.9 * 6.2e-27 28.4 %
:HMM:SCOP  130->210 2fy8A2 d.286.1.1 * 4.5e-16 35.8 %
:RPS:PFM   7->119 PF02254 * TrkA_N 3e-08 27.4 %
:RPS:PFM   161->210 PF02080 * TrkA_C 8e-07 44.9 %
:HMM:PFM   5->120 PF02254 * TrkA_N 3.9e-23 31.6 114/116  
:HMM:PFM   149->210 PF02080 * TrkA_C 1.6e-15 34.4 61/71  
:BLT:SWISS 1->210 KTRC_BACSU 1e-38 36.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98890.1 GT:GENE ktrA GT:PRODUCT Potassium uptake protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 87718..88356 GB:FROM 87718 GB:TO 88356 GB:DIRECTION + GB:GENE ktrA GB:PRODUCT Potassium uptake protein GB:NOTE COG0569 [P] K+ transport systems, NAD-binding component GB:PROTEIN_ID ABD98890.1 GB:DB_XREF GI:90820251 GB:GENE:GENE ktrA LENGTH 212 SQ:AASEQ MDRSYAVFGLGEFGRSVSYELMEIGADVLAVDKNENKITAIADDVTMAISIDALNEMAYEKLGLNNMDGVVVSMSGNLSASIMAIIAAKDAGVPLVIAKASDDTQRTIFKKVGADRVVIPERDGAVRTAHNLVAKNFLDYIELSDKISIIEINVKDEWLHKPLAELNLRSKYGLNVIAIRRNNDLQTDIGPNLTFDKGDTILVVTDKHDLGL GT:EXON 1|1-212:0| BL:SWS:NREP 1 BL:SWS:REP 1->210|KTRC_BACSU|1e-38|36.2|210/221| BL:PDB:NREP 1 BL:PDB:REP 2->140|2hmtA|2e-24|36.7|139/139| RP:PDB:NREP 1 RP:PDB:REP 48->210|2bkoA|2e-14|14.7|156/190| RP:PFM:NREP 2 RP:PFM:REP 7->119|PF02254|3e-08|27.4|113/116|TrkA_N| RP:PFM:REP 161->210|PF02080|8e-07|44.9|49/71|TrkA_C| HM:PFM:NREP 2 HM:PFM:REP 5->120|PF02254|3.9e-23|31.6|114/116|TrkA_N| HM:PFM:REP 149->210|PF02080|1.6e-15|34.4|61/71|TrkA_C| GO:PFM:NREP 3 GO:PFM GO:0006813|"GO:potassium ion transport"|PF02254|IPR003148| GO:PFM GO:0006813|"GO:potassium ion transport"|PF02080|IPR006037| GO:PFM GO:0008324|"GO:cation transmembrane transporter activity"|PF02080|IPR006037| RP:SCP:NREP 2 RP:SCP:REP 5->130|1id1A|2e-13|18.4|125/153|c.2.1.9| RP:SCP:REP 136->210|1vctA2|9e-14|22.7|75/94|d.286.1.1| HM:SCP:REP 3->136|1lsuA_|6.2e-27|28.4|134/134|c.2.1.9|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 130->210|2fy8A2|4.5e-16|35.8|81/0|d.286.1.1|1/1|TrkA C-terminal domain-like| OP:NHOMO 413 OP:NHOMOORG 375 OP:PATTERN -----------------------11--111----1-1112---------1------------------ -21--11----111----------------------1-------11111111111221--11---11---11111-11----11----1111-1--1---1--1----1-----------------1-------1111111----11111111112211111111111111111111111111111--11--2211111111111111123221211111122111111111211111111111111111111111----1---1111---1-11----11111111--1111111111111111111111111111111111-32--1111111111-1111111211212111111111-1111111-111-11---------------------------------------1------------------------1-------------------------------------------------------1------------------------------------------------1---11-----------------21--2211122122222----1---2------1111--1-111111-1-------11-----11-----1----1111---1111-2--1----------------------------------------------------------------------------------------------------------------1--1------------11-1111111111----------1----1-------------1111-----12111----------------11111111---1--1-221----1-1111111111111111-----1--1-1----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 210 STR:RPRED 99.1 SQ:SECSTR ccccEEEEcccHHHHHHHHHcTTcEEEEEEccGGGHHHHHHTTcEEEcHHHHHHHHHHHHHHHHHHHHHHHHHTcHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHcccEEEEEEccTTTTTccHHHHTHHHHHccEEEEEEETTEEEEcccTTccccTTcEEEEEEcHHHH## DISOP:02AL 1-1| PSIPRED cccEEEEEcccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHcccEEEEcccccHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccccEEcHHHHHHHHHHHHHHHHHHHHHEEcccccEEEEEEccHHHccccHHHHcccccccEEEEEEEEccEEEEccccccEEccccEEEEEEcHHHccc //