[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : lexA
DDBJ      :lexA         LexA repressor
Swiss-Prot:LEXA_LACS1   RecName: Full=LexA repressor;         EC=3.4.21.88;

Homologs  Archaea  0/68 : Bacteria  632/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5b.87.1
:206 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->204 1jhhA PDBj 3e-26 34.6 %
:RPS:PDB   7->67 1dpuA PDBj 6e-10 18.6 %
:RPS:PDB   105->205 1ay9A PDBj 9e-23 28.3 %
:RPS:SCOP  23->79 2pg4A1  a.4.5.48 * 2e-16 29.8 %
:RPS:SCOP  105->205 1ay9A  b.87.1.1 * 3e-23 28.3 %
:HMM:SCOP  2->69 1jhfA1 a.4.5.2 * 3.3e-19 52.9 %
:HMM:SCOP  82->204 1jhfA2 b.87.1.1 * 3.1e-34 41.0 %
:RPS:PFM   7->65 PF01726 * LexA_DNA_bind 4e-16 59.3 %
:HMM:PFM   3->65 PF01726 * LexA_DNA_bind 1.2e-25 50.8 63/65  
:HMM:PFM   124->189 PF00717 * Peptidase_S24 3.3e-18 33.8 65/70  
:BLT:SWISS 1->206 LEXA_LACS1 e-117 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99349.1 GT:GENE lexA GT:PRODUCT LexA repressor GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(583018..583638) GB:FROM 583018 GB:TO 583638 GB:DIRECTION - GB:GENE lexA GB:PRODUCT LexA repressor GB:NOTE COG1974 [KT] SOS-response transcriptional repressors (RecA-mediated autopeptidases) GB:PROTEIN_ID ABD99349.1 GB:DB_XREF GI:90820710 GB:GENE:GENE lexA LENGTH 206 SQ:AASEQ MTKSEKRQHDILRYIFSHVSDSGYPPTVREICNAVGLSSTSTVHGHLSKLESKGLIKRDPTKPRAIEITLAGLEMLDELPNKTQIPIVGTVTAGEPILAVEENRDYFPLPPYFESADDLFMLSIRGESMINAGILDGDQVIVRKQSSANNGEIVIAMTEENEATCKRFFKEDGYYRLQPENDTMDPIILENVTILGKVVGLYRDLI GT:EXON 1|1-206:0| SW:ID LEXA_LACS1 SW:DE RecName: Full=LexA repressor; EC=3.4.21.88; SW:GN Name=lexA; OrderedLocusNames=LSL_0540; SW:KW Autocatalytic cleavage; Complete proteome; DNA damage; DNA repair;DNA replication; DNA-binding; Hydrolase; Repressor; SOS response;Transcription; Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->206|LEXA_LACS1|e-117|100.0|206/206| GO:SWS:NREP 8 GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| GO:SWS GO:0006260|"GO:DNA replication"|DNA replication| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0009432|"GO:SOS response"|SOS response| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| BL:PDB:NREP 1 BL:PDB:REP 7->204|1jhhA|3e-26|34.6|188/197| RP:PDB:NREP 2 RP:PDB:REP 7->67|1dpuA|6e-10|18.6|59/69| RP:PDB:REP 105->205|1ay9A|9e-23|28.3|99/108| RP:PFM:NREP 1 RP:PFM:REP 7->65|PF01726|4e-16|59.3|59/64|LexA_DNA_bind| HM:PFM:NREP 2 HM:PFM:REP 3->65|PF01726|1.2e-25|50.8|63/65|LexA_DNA_bind| HM:PFM:REP 124->189|PF00717|3.3e-18|33.8|65/70|Peptidase_S24| GO:PFM:NREP 2 GO:PFM GO:0004252|"GO:serine-type endopeptidase activity"|PF01726|IPR006199| GO:PFM GO:0006508|"GO:proteolysis"|PF01726|IPR006199| RP:SCP:NREP 2 RP:SCP:REP 23->79|2pg4A1|2e-16|29.8|57/92|a.4.5.48| RP:SCP:REP 105->205|1ay9A|3e-23|28.3|99/108|b.87.1.1| HM:SCP:REP 2->69|1jhfA1|3.3e-19|52.9|68/0|a.4.5.2|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 82->204|1jhfA2|3.1e-34|41.0|122/126|b.87.1.1|1/1|LexA/Signal peptidase| OP:NHOMO 712 OP:NHOMOORG 633 OP:PATTERN -------------------------------------------------------------------- 111-111111111111111-11111111111111112222111111111111111111--111-2121111111111111111--1-1--------------------1---------------1------1----11111114111111111----11111111-1111-11-111111111--1--11-12111111211112212121221111111111111111111311111111111111-1111111-11111111111111111111-----------------------------------------------32122222222212121221112112-1112221122211221---11--1-11111-1111111111111111111111111111-11111111111-1111111111111111111111111111111111111111111-----------------------------111111111111111111111111111111111111111121111111111111111111-1------------11111-1--12-------2-211211311111112-------------------------11111111111111111111111111111111----112------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---------211-11121111111111111111----------1111112222122221224---------11111111111111111222222221111--11111112------------------------------------1111111111-2- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 205 STR:RPRED 99.5 SQ:SECSTR ccccTTHHHHHHHHHHHcccTTTGHEEHHHHHHHcTTccHHHHHHHHHHHHHTTcEEEcTTEEEEccEcHHHHHHHHHHGGcHHHHHEccccTTHHHHTcccccccccHHHHHccGGGEEEEEccccTTGGGTccTTcEEEEEccccccTTcEEEEEETTTEEEEEEEEccccccEEEcccTTcccEEcccEEEEEEEEEEEccc# DISOP:02AL 1-3,62-77| PSIPRED cccccHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccHHHHHHHHHHHHccccccccccccccccccccHHHHHccccccccccccccccccccccccccccEEEccHHHccccccEEEEEEcccccccccccccEEEEEcccccccccEEEEEEccccEEEEEEEEEccEEEEEEcccccccEEccEEEEEEEEEEEEEEcc //