[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : maoC
DDBJ      :maoC         Dehydrogenase with MaoC-like domain
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  110/915 : Eukaryota  12/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:146 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   38->143 1iq6B PDBj 2e-11 29.2 %
:RPS:PDB   11->146 2bi0A PDBj 5e-14 6.9 %
:RPS:SCOP  7->140 1q6wA  d.38.1.4 * 8e-21 23.1 %
:HMM:SCOP  12->143 1iq6A_ d.38.1.4 * 1.5e-23 26.5 %
:RPS:PFM   13->109 PF01575 * MaoC_dehydratas 1e-04 25.8 %
:HMM:PFM   20->124 PF01575 * MaoC_dehydratas 6.2e-12 20.8 101/123  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99295.1 GT:GENE maoC GT:PRODUCT Dehydrogenase with MaoC-like domain GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 535249..535689 GB:FROM 535249 GB:TO 535689 GB:DIRECTION + GB:GENE maoC GB:PRODUCT Dehydrogenase with MaoC-like domain GB:NOTE COG2030 [I] Acyl dehydratase GB:PROTEIN_ID ABD99295.1 GB:DB_XREF GI:90820656 GB:GENE:GENE maoC LENGTH 146 SQ:AASEQ MSEDVHRRGKTIDEIKEGDSLTVTESISDRDLLLYLGITNDNNPLYIQHDYARDTEYQKPIVPPVLLTGIITSSISKVLPGPGSDVVNLSTNFILPVYHDEMVTFSFEVIKVDSMKEVITISVEGENEDGDRVIDAVVIVKPPKIF GT:EXON 1|1-146:0| TM:NTM 2 TM:REGION 58->80| TM:REGION 86->108| BL:PDB:NREP 1 BL:PDB:REP 38->143|1iq6B|2e-11|29.2|106/133| RP:PDB:NREP 1 RP:PDB:REP 11->146|2bi0A|5e-14|6.9|131/327| RP:PFM:NREP 1 RP:PFM:REP 13->109|PF01575|1e-04|25.8|93/116|MaoC_dehydratas| HM:PFM:NREP 1 HM:PFM:REP 20->124|PF01575|6.2e-12|20.8|101/123|MaoC_dehydratas| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF01575|IPR002539| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01575|IPR002539| RP:SCP:NREP 1 RP:SCP:REP 7->140|1q6wA|8e-21|23.1|134/151|d.38.1.4| HM:SCP:REP 12->143|1iq6A_|1.5e-23|26.5|132/0|d.38.1.4|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 164 OP:NHOMOORG 122 OP:PATTERN -------------------------------------------------------------------- --------------------------------------1----------------------------------------------------------------1----1------------------------------11---1-----------------------------------------1-----1-333332232323222------2321111---------1---------------------1-----------------1----------------------------------------------------12-2------------11-----1-1-1---------3------1--1----2111-------1-1----111---------------1--2------------------1--1-1112222112--------2------1---------------------------------------------1--------1----------1----11-1-----1----1-------1----------111--1---------------------------------------------------------1--1-1-----------1---------1-----11---------------------------------------------------------------------------------------------------------1----------------------------11111--1-1-----111------------------------------------------11--11----------1-------------------------1111--1------ -----11--------------------------------------------------------------------------------------------------------1111------------2--1------------3-----------1---1--------------1------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 142 STR:RPRED 97.3 SQ:SECSTR ####ccccccccccGGGTTcEEEcccEEcccHHHHHHHTTcccGGGTcTTTTccEEcccccccHHHHHHHHHHHHHHHcTTccEEEEEEEEEEcccccTTcEEEEEEEEEEEEEcccEEEEEEEEEEccccTTcccEEEEEEEEEE DISOP:02AL 1-1,3-3| PSIPRED ccccHHHccccHHHEEcccEEEEEEEccHHHHHHHHHHHcccccEEccHHHHHHcccccccccHHHHHHHHHHHHHHHccccEEEEEEEEEEEccccccccEEEEEEEEEEEEccccEEEEEEEEEEccccEEEEEEEEEEEcccc //