[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : mapA
DDBJ      :mapA         maltose phosphorylase
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  185/915 : Eukaryota  75/199 : Viruses  0/175   --->[See Alignment]
a.102.1b.30.5
:754 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->741 1h54B PDBj 0.0 63.0 %
:RPS:PDB   2->752 2eabA PDBj 9e-65 11.1 %
:RPS:SCOP  1->268 1h54A2  b.30.5.3 * 2e-70 55.4 %
:RPS:SCOP  273->745 1h54A1  a.102.1.4 * 7e-83 64.9 %
:HMM:SCOP  1->268 1h54A2 b.30.5.3 * 1e-84 41.0 %
:HMM:SCOP  271->750 1h54A1 a.102.1.4 * 1.6e-144 34.4 %
:RPS:PFM   19->267 PF03636 * Glyco_hydro_65N 1e-37 41.6 %
:RPS:PFM   323->696 PF03632 * Glyco_hydro_65m 2e-92 47.2 %
:RPS:PFM   700->750 PF03633 * Glyco_hydro_65C 3e-11 51.0 %
:HMM:PFM   323->696 PF03632 * Glyco_hydro_65m 1.7e-145 49.1 369/370  
:HMM:PFM   13->268 PF03636 * Glyco_hydro_65N 4.1e-72 39.0 249/255  
:HMM:PFM   700->751 PF03633 * Glyco_hydro_65C 3.6e-17 42.3 52/54  
:BLT:SWISS 2->750 YVDK_BACSU 0.0 53.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00087.1 GT:GENE mapA GT:PRODUCT maltose phosphorylase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1318089..1320353) GB:FROM 1318089 GB:TO 1320353 GB:DIRECTION - GB:GENE mapA GB:PRODUCT maltose phosphorylase GB:NOTE COG1554 [G] Trehalose and maltose hydrolases (possible phosphorylases) GB:PROTEIN_ID ABE00087.1 GB:DB_XREF GI:90821448 GB:GENE:GENE mapA LENGTH 754 SQ:AASEQ MKRIFEVDPWKVISHELKPEDKRLQESMTSIGNEYMGMRGMFEEKYSGDTHKGIYLGGVWFPDKTVVGWWKNGYPHYFGKVINAVDFVSVDIKVNGESIDLAKDSYSDYEVSLDMKKGILTRSYVVDKNGAKVKVTSTRFVSIAFKELYANKLTFENLGSEPVTLEVDSVIDADVYNEDANYDEQFWNVLSKQVSAKDGRLVAQTIPNNFGTPQFTTEMAMHHVTDMEAKGLGKEEDKQVVNTFAKELAANEKVAFEKRVIVTTSRDYADEKDLDEATSKLLDSQAEKTFSELLTAHEEAWDKRWEKADVKIEGSDEAQQGIRFNLFQLFSTYYGDDARLNIGPKGFTGEKYGGATYWDTEAFAVPLYLALADKEVTHNLLEYRHNQLPGAYHNAQEQGLKGALYPMVTFNGIECHNEWEITFEEIHRNGTIAYAIYNYTRYTGDEEYVTHDGFDVLTGIARFWADRVHYSQRKGLYMIHGVTGPNEYENNVNNNWYTNMLAKWCLNYTNEIADKVSDEKLAELGLTEEERNKWHEIADNMYLPEDKELGIFVQHDTFLDKDLTPVADIPADQLPLNQNWSWDKILRSPYIKQGDVMQGIWYFIDKFPEDVKKRNFEFYEPLTVHESSLSPSVHAIIAADLHKEDKAVEMYSRTARLDLDNYNNDTNDGLHITSMTGSWLAIVQGFAGMRVIDDELQFSPFVPKDWEGYNFRINFRDRLLEVTVNKEGSSIKLLKGDDLTIKLNGESLTLTTEK GT:EXON 1|1-754:0| BL:SWS:NREP 1 BL:SWS:REP 2->750|YVDK_BACSU|0.0|53.4|743/757| SEG 486->499|neyennvnnnwytn| SEG 657->670|ldldnynndtndgl| BL:PDB:NREP 1 BL:PDB:REP 1->741|1h54B|0.0|63.0|741/754| RP:PDB:NREP 1 RP:PDB:REP 2->752|2eabA|9e-65|11.1|737/888| RP:PFM:NREP 3 RP:PFM:REP 19->267|PF03636|1e-37|41.6|233/252|Glyco_hydro_65N| RP:PFM:REP 323->696|PF03632|2e-92|47.2|371/372|Glyco_hydro_65m| RP:PFM:REP 700->750|PF03633|3e-11|51.0|51/53|Glyco_hydro_65C| HM:PFM:NREP 3 HM:PFM:REP 323->696|PF03632|1.7e-145|49.1|369/370|Glyco_hydro_65m| HM:PFM:REP 13->268|PF03636|4.1e-72|39.0|249/255|Glyco_hydro_65N| HM:PFM:REP 700->751|PF03633|3.6e-17|42.3|52/54|Glyco_hydro_65C| GO:PFM:NREP 5 GO:PFM GO:0003824|"GO:catalytic activity"|PF03636|IPR005196| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF03636|IPR005196| GO:PFM GO:0030246|"GO:carbohydrate binding"|PF03636|IPR005196| GO:PFM GO:0003824|"GO:catalytic activity"|PF03632|IPR005195| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF03632|IPR005195| RP:SCP:NREP 2 RP:SCP:REP 1->268|1h54A2|2e-70|55.4|267/267|b.30.5.3| RP:SCP:REP 273->745|1h54A1|7e-83|64.9|473/485|a.102.1.4| HM:SCP:REP 1->268|1h54A2|1e-84|41.0|268/268|b.30.5.3|1/1|Galactose mutarotase-like| HM:SCP:REP 271->750|1h54A1|1.6e-144|34.4|480/0|a.102.1.4|1/1|Six-hairpin glycosidases| OP:NHOMO 383 OP:NHOMOORG 262 OP:PATTERN ----------------1---------------------------------------1----------- ----1--1---111-1122-22113222222122221221-1112111----12211---1111112-211-----------------11----------23-111-1-----------------221222222-2111----------1-----------------221----------------------1------------------11-1--------12222222----------------------212-11-1111441111-1132-223--------------------------------------------2--1-----------12----1-4---------------3---2222--------------------1-------------------3213121---------------------------------------------------------------------------------1------------------------------------------1-----------------311111-----------------------------------1-----------------------------------1--------1-------------1---1-1--------1---1-1111111111-11111-111111-11111--------1-1------------------1111-----------------------------------------------------------------------------------------------------------------------------------------------1-11----2---11-----1--------1- ----111-422----1111--------------1-1--------11--11--------------1111--1111-1111111111-------1-------1--------1411111--1---1111-1-5A1--25-1--1-111-1-------11111121152--118---4------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 752 STR:RPRED 99.7 SQ:SECSTR cGGGccccccccTTccccHHHHHHHHHcEEEEcccEEEEEcccccccccTTccccccTTccHHHHGGGHHHHHHHHHHccccccTTccccccHHEEEEccccccccEEEEEEEETTTTEEEEEEEETTEEEccEEEEEEEEETTTTTEEEEEEEEccTTcEEEEEEccccTTccEEEEEEEEEETTEEEEEEEETTTccEEEEEEEGGGccEEEEcTTcccEEEEEEcEEEEEEEcccccTTTccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHTTcEEEcccccccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHHcccTTccccccTTcTccccccccTTTTHHHHHTccTTTTTcGGGGHHHHHHHHHTHHHHHHHHHHHHccccccTTTcccccccccEEcTTccccTHHHHHHHHHHHHHHTTccHHHHTHHHHHHHHHHHHHHHHHTcEEcccGGGcccEEccEEEETTEEEEEEEccHHHHHHHHHHHHHHHHHHcTTcHHTTcTTccccccTTccGGGGcccTTcccccTTccccHHHHHHHHccccccTTccccccTTcccTTccTTccccTTcccccTTcHHHHHHHHHHHHHHHEETTEEccccHHHHHHHHHHTTcHHHHHHHHHHHHHHcccTTcccccccccTHHHHHHHHHHHHcccEEEcTETcEEEcTTccTTcccEEEEEEEETTTEEEEEEEETTEEEEcccccEEEEETTTcGGGEE## DISOP:02AL 337-337,751-755| PSIPRED cccccccccEEEEEEcccHHHHHHHHHHHEEEcccEEEEccccccccccccccEEEEEEEcccccccccccccccccccEEEEcccccEEEEEEccEEEEccccEEEEEEEEEEccccEEEEEEEEEccccEEEEEEEEEEEcccccEEEEEEEEEEcccccEEEEEEEccccEEEEccccccccccccccccccccEEEEEEEEEccccccEEEEEEEEEEEEEEEEEEEEEEcccEEEEEEEEEEEccccEEEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccEEEcccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEccccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHccHHHHHHHHHHHHHHEEEEccccEEEEccccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccccEEEccccccccccccccccccccccccccccccccccccEEEEHHHHHHHHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHccccEEEEccEEEEcccccccccEEEEEEEEccEEEEEEEcccEEEEEEEccccEEEEEccEEEEEEccc //