[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : menB
DDBJ      :menB         Naphthoate synthase
Swiss-Prot:             

Homologs  Archaea  34/68 : Bacteria  648/915 : Eukaryota  162/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:273 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->273 2uzfA PDBj e-109 71.9 %
:RPS:PDB   12->267 1ef9A PDBj 6e-57 28.7 %
:RPS:SCOP  21->266 1uiyA  c.14.1.3 * 3e-63 32.0 %
:HMM:SCOP  8->267 1wdkA4 c.14.1.3 * 1.4e-71 34.4 %
:RPS:PFM   24->193 PF00378 * ECH 1e-26 41.6 %
:HMM:PFM   24->194 PF00378 * ECH 4.8e-51 35.3 170/170  
:BLT:SWISS 5->273 MENB_BACSU e-117 71.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98989.1 GT:GENE menB GT:PRODUCT Naphthoate synthase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 200216..201037 GB:FROM 200216 GB:TO 201037 GB:DIRECTION + GB:GENE menB GB:PRODUCT Naphthoate synthase GB:NOTE COG0447 [H] Dihydroxynaphthoic acid synthase GB:PROTEIN_ID ABD98989.1 GB:DB_XREF GI:90820350 GB:GENE:GENE menB LENGTH 273 SQ:AASEQ MTSVEWEKVKDYSEIIFERAGQIAKITMNRPEKHNAFTPVTVAEMIEAFTICRDDSTIGAIILTGAGDKAFSSGGDQTVRGNGGYVGPDKIARLNVLDLQHLIRIIPKPVIAMVKGWSVGGGNVLQLVCDLTIAADNAMFGQTGPKVGSFDAGYGSGYLARVIGHKRAKEVWFLNHFYTAQEAYEMNWINKVVPLDEVESVTLDWCNEILQKSPTAIRFIKAAMNADTDGLAGLQQFAGDATMLYYTTDEGKEGRDAFNEKRKPDFQQFPKFP GT:EXON 1|1-273:0| BL:SWS:NREP 1 BL:SWS:REP 5->273|MENB_BACSU|e-117|71.0|269/271| BL:PDB:NREP 1 BL:PDB:REP 6->273|2uzfA|e-109|71.9|260/260| RP:PDB:NREP 1 RP:PDB:REP 12->267|1ef9A|6e-57|28.7|254/261| RP:PFM:NREP 1 RP:PFM:REP 24->193|PF00378|1e-26|41.6|166/170|ECH| HM:PFM:NREP 1 HM:PFM:REP 24->194|PF00378|4.8e-51|35.3|170/170|ECH| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00378|IPR001753| GO:PFM GO:0008152|"GO:metabolic process"|PF00378|IPR001753| RP:SCP:NREP 1 RP:SCP:REP 21->266|1uiyA|3e-63|32.0|244/253|c.14.1.3| HM:SCP:REP 8->267|1wdkA4|1.4e-71|34.4|259/0|c.14.1.3|1/1|ClpP/crotonase| OP:NHOMO 4084 OP:NHOMOORG 844 OP:PATTERN 22-1--3876877865-121211A73322335-----------------------------2331-11 23439314112322HUIBB-BK33IUBBBBBFPMRMBMeh1I1I212511125434241186E16ACA585--------1518-----1111-1211--31222244322--------------11111121111145544---3611111111111111111111-111111111111111122123---6524444433545353333733335435BA75411111118-111111111111111111111-1----1-----11---1-111111---1111111111-111111111111111111111--111---1--1131111111212-2221221-2-1-3-11-561427-15---1--2-2--B66E-----6-PDE313MDKEB67766674776-116-1B177AP-7332557878A87A5F66883466679--------422--884-----------------------------1BFPA-2bPEK9DEBLA6666588AB888738F8VHSbL23BC7754A8DBFEHK226----63----------F684V991---------17972E12--33238552---------------------------221261524433454433633345464443---1-1-------21132125334543466-355643354534344544532311121232222222222222243323333--222222222222---1-----3333-552211111111111111199789174653177776856487885444----------121511111351333333333333-------1444422-----------------------------------------------11 ----444-321-437B842667656567746356543B78778545355687C7463343233--------------------------4528333111-314557-654C8768843423561B6382Eh6-9591252424661455-61272454B7743C56174598A76222-N11123455B7341456641 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 271 STR:RPRED 99.3 SQ:SECSTR ##cccTTTccccccEEEEEETTEEEEEEccGGGTTcccHHHHHHHHHHHHHTccTTccEEEEEccTTccEEEccccGGGcccccccTTccccHHHHHHHHHHHHHccccEEEEEccEEETHHHHHHHTccEEEEETTcEEEccGGGTTccccHHHHHTTTTTccHHHHHHHHHHcccEEHHHHHHTTcccEEEcHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHccHHHHHHHHHHHTTccccccccccTc DISOP:02AL 1-4,267-268| PSIPRED cccccHHHcccccEEEEEEEccEEEEEEccHHHHccccHHHHHHHHHHHHHHHHccccEEEEEEccccccEEccccHHHHcccccccHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHccEEEEccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccccEEccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccHHHccccc //