[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : minC
DDBJ      :minC         Cell division inhibitor
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  65/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.80.3
:223 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   67->161 1hf2C PDBj 2e-07 30.5 %
:HMM:SCOP  101->209 1hf2A1 b.80.3.1 * 8.7e-19 29.0 %
:RPS:PFM   109->173 PF03775 * MinC_C 2e-06 35.4 %
:HMM:PFM   107->182 PF03775 * MinC_C 1.3e-17 28.9 76/105  
:HMM:PFM   66->103 PF09744 * Jnk-SapK_ap_N 0.00015 26.3 38/158  
:BLT:SWISS 1->222 MINC_LISMF 4e-30 33.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99873.1 GT:GENE minC GT:PRODUCT Cell division inhibitor GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1088208..1088879) GB:FROM 1088208 GB:TO 1088879 GB:DIRECTION - GB:GENE minC GB:PRODUCT Cell division inhibitor GB:NOTE COG0850 [D] Septum formation inhibitor GB:PROTEIN_ID ABD99873.1 GB:DB_XREF GI:90821234 GB:GENE:GENE minC LENGTH 223 SQ:AASEQ MQKSVVLKGYKDGYEIELKADAAFSQILIELTELFERLKHEKEKNDEKIAFNIKTGARLLTIDQKHEIEKIVDNYPNFLVHRIVSDVINTKEALQIMDSKNVHVNGDVIRNGQVKDITGDVLFLGNLHQGGVLRATGNIYVMGSVSGIIHAGFDSNVRSIILGDISGAQQLRIGDLVDIVDEEKVTAGTDSLVFVNDLHVLEFTSIDKLKSLRPKIFNQVGGF GT:EXON 1|1-223:0| BL:SWS:NREP 1 BL:SWS:REP 1->222|MINC_LISMF|4e-30|33.0|221/225| BL:PDB:NREP 1 BL:PDB:REP 67->161|1hf2C|2e-07|30.5|95/202| RP:PFM:NREP 1 RP:PFM:REP 109->173|PF03775|2e-06|35.4|65/104|MinC_C| HM:PFM:NREP 2 HM:PFM:REP 107->182|PF03775|1.3e-17|28.9|76/105|MinC_C| HM:PFM:REP 66->103|PF09744|0.00015|26.3|38/158|Jnk-SapK_ap_N| HM:SCP:REP 101->209|1hf2A1|8.7e-19|29.0|107/0|b.80.3.1|1/1|Cell-division inhibitor MinC, C-terminal domain| OP:NHOMO 65 OP:NHOMOORG 65 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------1111-------------------------------------------------------------------------------------------------------111111111111111111111111111111111111111111----------------------1-11-----11--1111------------------------------------------------------------------1---------1---1-----1----1-1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 107 STR:RPRED 48.0 SQ:SECSTR ##################################################################GHHHHHHHHHHTTcEEEEEEEEEEcccEEEEEEEEccccEEEEcTTcEEEEccEEEEcccccTTcEEEEcccEEEEEEEccEEEEcTTTcTTccE#########EEEEEEcccHHH######################################### DISOP:02AL 1-2,87-97,223-224| PSIPRED cccEEEEEEcccEEEEEEcccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccccHHHHHHHHHHHHcccccEEEEcccccccccccccccccccEEEEccEEccccEEEEcccEEEEEccccccEEEEcccEEEEEEEEEEEEEcccccccEEEEEEccccEEEEcccEEEccccccccccccEEEEEccccEEEEEEccccccccHHHccccccc //