[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : mmsB
DDBJ      :mmsB         3-hydroxyisobutyrate dehydrogenase
Swiss-Prot:             

Homologs  Archaea  28/68 : Bacteria  587/915 : Eukaryota  174/199 : Viruses  0/175   --->[See Alignment]
a.100.1c.2.1
:287 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->287 3ckyC PDBj 6e-38 30.5 %
:RPS:PDB   1->286 3ckyC PDBj 3e-77 31.3 %
:RPS:SCOP  2->162 1vpdA2  c.2.1.6 * 3e-45 40.6 %
:RPS:SCOP  163->286 3cumA1  a.100.1.1 * 6e-26 26.8 %
:HMM:SCOP  1->163 1pgpA2 c.2.1.6 * 1.8e-49 44.3 %
:HMM:SCOP  164->288 2cvzA1 a.100.1.1 * 1.2e-30 38.7 %
:RPS:PFM   1->154 PF03446 * NAD_binding_2 2e-31 44.7 %
:HMM:PFM   1->162 PF03446 * NAD_binding_2 6.4e-54 43.5 161/163  
:BLT:SWISS 3->286 YKWC_BACSU 3e-66 42.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98833.1 GT:GENE mmsB GT:PRODUCT 3-hydroxyisobutyrate dehydrogenase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(10418..11281) GB:FROM 10418 GB:TO 11281 GB:DIRECTION - GB:GENE mmsB GB:PRODUCT 3-hydroxyisobutyrate dehydrogenase GB:NOTE COG2084 [I] 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases GB:PROTEIN_ID ABD98833.1 GB:DB_XREF GI:90820194 GB:GENE:GENE mmsB LENGTH 287 SQ:AASEQ MKIGFIGTGVMGNAISVNLLKAGYEMVVYNRTKSKTDNLVSLGASWADSPKEVARQSDIIFTMVGFPPDVEDVYFNSETGIFAGAKPQSILVDMTTSRPSLAQKIYQEGQKRNLFVLDAPVSGGDIGAKNGTLTVMVGGDKEAFDKLTDILEVISQSYHLFGPAGSGQHAKMADQIMIAGTMTGLTEMLVYAKKAGLDLDSILTTVGAGSAANWSLSNYGPRILASDYTPGFFAKHFLKDLRIALDSAKNMGISLPATEKAEELYQTMVDEFKLGNDGTQGLIKIYD GT:EXON 1|1-287:0| BL:SWS:NREP 1 BL:SWS:REP 3->286|YKWC_BACSU|3e-66|42.6|282/288| BL:PDB:NREP 1 BL:PDB:REP 1->287|3ckyC|6e-38|30.5|285/296| RP:PDB:NREP 1 RP:PDB:REP 1->286|3ckyC|3e-77|31.3|284/296| RP:PFM:NREP 1 RP:PFM:REP 1->154|PF03446|2e-31|44.7|150/160|NAD_binding_2| HM:PFM:NREP 1 HM:PFM:REP 1->162|PF03446|6.4e-54|43.5|161/163|NAD_binding_2| GO:PFM:NREP 3 GO:PFM GO:0004616|"GO:phosphogluconate dehydrogenase (decarboxylating) activity"|PF03446|IPR006115| GO:PFM GO:0006098|"GO:pentose-phosphate shunt"|PF03446|IPR006115| GO:PFM GO:0055114|"GO:oxidation reduction"|PF03446|IPR006115| RP:SCP:NREP 2 RP:SCP:REP 2->162|1vpdA2|3e-45|40.6|160/161|c.2.1.6| RP:SCP:REP 163->286|3cumA1|6e-26|26.8|123/134|a.100.1.1| HM:SCP:REP 1->163|1pgpA2|1.8e-49|44.3|158/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 164->288|2cvzA1|1.2e-30|38.7|124/0|a.100.1.1|1/1|6-phosphogluconate dehydrogenase C-terminal domain-like| OP:NHOMO 2136 OP:NHOMOORG 789 OP:PATTERN ----1-11222222211411111----1-1-------------1------1----1-----111--11 225-221-------56411-15--281111115666247623281111----537322--212-1-63421-------1-1-4211-----1-------------1-3-----------------1-111-111-132223---1342112221-1122212221112221-111---1-11-12112---4132242423323232223222233323332333111111311-------------------2-1-22-111111--221211211-1---------------------------------------------2-11-------1-2-1---11------111--33----11-111-----2123222-----429B72233534211231333224-22811B2B462-5554546866787722243422226471111111171122111-----------------------------32243-2963A79988783331779C777736B5G9A86-4553343335286772321--1331111111111223-22--32-111--2-2-212221111111--11-------------111-11-----1121223-222322222223222222222222---1112------2211-114334454544-34444444243433444414443211-4244434444434344132122331--11111111111----1111-1111133531113-2--1-1111133333241123-66663543433343323-1-1--1-11311211111332221132222222------2---1111----1---1-1------------------2--------1--1-1113-- 11--111-422-21295544444664422222222223334332223311-396222221221-1-----111--111-11---1----11252212111211212-28345435331211122322416I2-33512212-222121222124132232234322132B111211433X342-376AA5A64286554 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 287 STR:RPRED 100.0 SQ:SECSTR cEEEEEcccTTHHHHHHHHHHTTcEEEEEcccHHHHHHHHTTTcEEcccHHHHHHHccEEEEccccHHHHHHHHTccTTcHHHHccTTcEEEEcccccHHHHHHHHHHHHHTTcEEEEccEEcHHHHHHHTcEEEEEEccHHHHHHHHHHHHHHEEEEEEEEcTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHTcTTccHHHHHHcccccTccccccccHHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHTTTcTTccGGGGHHHHE PSIPRED cEEEEEcccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHcccEEEccHHHHHccccEEEEEccccHHHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHcccEEEEccccccccccccccEEEEEcccHHHHHHHHHHHHHHHccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccHHHHHHHHc //