[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : mreD
DDBJ      :mreD         Rod shape-determining protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:170 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->167 PF04093 * MreD 1.4e-19 19.4 155/160  
:BLT:SWISS 8->166 MRED_BACSU 7e-06 18.9 %
:TM
:REPEAT 2|12->54|67->115

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99874.1 GT:GENE mreD GT:PRODUCT Rod shape-determining protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1088897..1089409) GB:FROM 1088897 GB:TO 1089409 GB:DIRECTION - GB:GENE mreD GB:PRODUCT Rod shape-determining protein GB:NOTE COG1792 [M] Cell shape-determining protein GB:PROTEIN_ID ABD99874.1 GB:DB_XREF GI:90821235 GB:GENE:GENE mreD LENGTH 170 SQ:AASEQ MRTEKMNYYFPIGLFLAMFLDGGLTQVFAKQMFTNTMAMESRLVLLFIVMAVCYGNVEHLVMWSAIVGLFYDMFYTGILGVFTMILPLMVYVTKYMFQFFTRSFIVVLLIYLIDITIVTFLFFWANSLVDFTNATITDLIGRTLGPTLIYNLAWFVVLFLPLEHFFETNY GT:EXON 1|1-170:0| BL:SWS:NREP 1 BL:SWS:REP 8->166|MRED_BACSU|7e-06|18.9|159/172| TM:NTM 5 TM:REGION 10->32| TM:REGION 37->59| TM:REGION 66->88| TM:REGION 103->125| TM:REGION 146->168| NREPEAT 1 REPEAT 2|12->54|67->115| HM:PFM:NREP 1 HM:PFM:REP 5->167|PF04093|1.4e-19|19.4|155/160|MreD| OP:NHOMO 28 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------1--------1-1111111----------------------1-1-11-1--1111111111---111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //