[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : murB
DDBJ      :murB         UDP-N-acetylenolpyruvoylglucosamine reductase
Swiss-Prot:MURB_LACS1   RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;         EC=1.1.1.158;AltName: Full=UDP-N-acetylmuramate dehydrogenase;

Homologs  Archaea  1/68 : Bacteria  646/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
d.145.1d.146.1
:299 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->298 1hskA PDBj 7e-67 43.7 %
:RPS:PDB   4->299 1e8gA PDBj 3e-44 11.5 %
:RPS:SCOP  4->191 1hskA1  d.145.1.2 * 6e-40 40.4 %
:RPS:SCOP  193->299 1hskA2  d.146.1.1 * 3e-35 62.6 %
:HMM:SCOP  1->192 1hskA1 d.145.1.2 * 2.3e-51 38.0 %
:HMM:SCOP  193->301 1hskA2 d.146.1.1 * 4e-36 51.4 %
:RPS:PFM   200->297 PF02873 * MurB_C 6e-15 51.0 %
:HMM:PFM   196->297 PF02873 * MurB_C 2e-31 47.1 102/105  
:HMM:PFM   34->161 PF01565 * FAD_binding_4 4.1e-29 32.3 127/138  
:BLT:SWISS 1->299 MURB_LACS1 e-162 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99956.1 GT:GENE murB GT:PRODUCT UDP-N-acetylenolpyruvoylglucosamine reductase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1181836..1182735) GB:FROM 1181836 GB:TO 1182735 GB:DIRECTION - GB:GENE murB GB:PRODUCT UDP-N-acetylenolpyruvoylglucosamine reductase GB:NOTE COG0812 [M] UDP-N-acetylmuramate dehydrogenase GB:PROTEIN_ID ABD99956.1 GB:DB_XREF GI:90821317 GB:GENE:GENE murB LENGTH 299 SQ:AASEQ MTTNDLRELFLDLNVKFDEELKKYTNTKTGGKADVLAFPDSIEETEKLIKIAKKNNVPLTILGNASNLIVKDGGIRGLVVILQHLDQITVDGTKVTAQAGASLIGTTRVAAKHSLTGMEFASGIPGSIGGAIFMNAGAYGGEIKNIVESVKLLTRDGEYKTYTVDELDFGYRHSRLQSEDDIVVAATFKLEHGDIKKIRERMEELSFLRASKQPLEYPSCGSVFKRPAGHFTGKLVYDSGLQGYTVGGVQVSKKHAGFIVNIGNGTGKDYLDVIHHVQAVVKEKFDVELETEVRIIGED GT:EXON 1|1-299:0| SW:ID MURB_LACS1 SW:DE RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase; EC=1.1.1.158;AltName: Full=UDP-N-acetylmuramate dehydrogenase; SW:GN Name=murB; OrderedLocusNames=LSL_1148; SW:KW Cell cycle; Cell division; Cell shape;Cell wall biogenesis/degradation; Complete proteome; Cytoplasm; FAD;Flavoprotein; NADP; Oxidoreductase; Peptidoglycan synthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->299|MURB_LACS1|e-162|100.0|299/299| GO:SWS:NREP 8 GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0008360|"GO:regulation of cell shape"|Cell shape| GO:SWS GO:0007047|"GO:cellular cell wall organization"|Cell wall biogenesis/degradation| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0009252|"GO:peptidoglycan biosynthetic process"|Peptidoglycan synthesis| SEG 121->132|asgipgsiggai| BL:PDB:NREP 1 BL:PDB:REP 6->298|1hskA|7e-67|43.7|293/303| RP:PDB:NREP 1 RP:PDB:REP 4->299|1e8gA|3e-44|11.5|295/550| RP:PFM:NREP 1 RP:PFM:REP 200->297|PF02873|6e-15|51.0|98/128|MurB_C| HM:PFM:NREP 2 HM:PFM:REP 196->297|PF02873|2e-31|47.1|102/105|MurB_C| HM:PFM:REP 34->161|PF01565|4.1e-29|32.3|127/138|FAD_binding_4| GO:PFM:NREP 3 GO:PFM GO:0008762|"GO:UDP-N-acetylmuramate dehydrogenase activity"|PF02873|IPR011601| GO:PFM GO:0009252|"GO:peptidoglycan biosynthetic process"|PF02873|IPR011601| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02873|IPR011601| RP:SCP:NREP 2 RP:SCP:REP 4->191|1hskA1|6e-40|40.4|188/194|d.145.1.2| RP:SCP:REP 193->299|1hskA2|3e-35|62.6|107/109|d.146.1.1| HM:SCP:REP 1->192|1hskA1|2.3e-51|38.0|192/0|d.145.1.2|1/1|FAD-binding domain| HM:SCP:REP 193->301|1hskA2|4e-36|51.4|109/109|d.146.1.1|1/1|Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain| OP:NHOMO 688 OP:NHOMOORG 651 OP:PATTERN ---------------------------------------------------1---------------- -111--1-221----1111-111111111111--1--1--1-------------1------------111--------2122121111-----1-----------111111111111111111111111121111311111---111111111111111111111111111111111111111111111111112222222222222221111112222111111111111211111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111-111111111111111111111111111111111111111111111111--11111111-----111111111111111111111111111-----111211-----------------------------------------1111-1-------111----1111111121111121311111111111-11111111111111111111111111111--1-1-1--11------1-111---11---1--1121------1-11-1----1-111--------11----1------1111--1111111111111111111---------1111111111111---11111111111-------1111111-11111111111-----111--1--1---1-111111111111--11------11111-1------------11111111111111111111--------------------------1111111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------1------1-----1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 296 STR:RPRED 99.0 SQ:SECSTR ###HHHHHHHcGGGEEEccccccccccTTcccccEEEccccHHHHHHHHHHHHHHTccEEEEcccccTTTTTTccccEEEEcTTTcccEETTTEEEEcTTccHHHHHHHHHHTTcTTTEEccccccTTccHHHHHHHTTcccTGGGEEEEEEEETTccEEEcGGGGccccccGGGTccGGGccccTTTTTcccccccccGccEEEEEEEEEcEEccccEEEEEEEEccTTHHHHHHHHHHHHHHTTccccccEEEEHHHHHHHHccGGGTccccccccHHHHHHHHHHHTcccEEEEEE DISOP:02AL 1-3| PSIPRED ccHHHHHHHHcccEEEEcccccccccccccccEEEEEEEccHHHHHHHHHHHHHccccEEEEccccEEEEccccccEEEEEccccccEEEcccEEEEEccccHHHHHHHHHHcccccccccccccccccccEEEccccccHHHHHEEEEEEEEcccccEEEEcHHHHcccHHHcccccccEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHcccccccccEEEccccccHHHHHHHHcccccEEEEcEEEccccccEEEEcccccHHHHHHHHHHHHHHHHHHHccccccccEEEccc //