[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : murC
DDBJ      :murC         UDP-N-acetylmuramate--alanine ligase
Swiss-Prot:MURC_LACS1   RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;         EC=6.3.2.8;AltName: Full=UDP-N-acetylmuramoyl-L-alanine synthetase;

Homologs  Archaea  3/68 : Bacteria  868/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
c.5.1c.59.1c.72.2
:443 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->426 1gqyB PDBj 2e-39 30.1 %
:RPS:PDB   17->422 2am1A PDBj 6e-56 14.4 %
:RPS:SCOP  9->91 1j6uA1  c.5.1.1 * 2e-19 35.4 %
:RPS:SCOP  102->296 1j6uA3  c.72.2.1 * 6e-32 28.2 %
:RPS:SCOP  297->437 1gqqA2  c.59.1.1 * 6e-26 32.6 %
:HMM:SCOP  4->92 1j6uA1 c.5.1.1 * 1.4e-20 40.9 %
:HMM:SCOP  89->296 1j6uA3 c.72.2.1 * 3e-58 38.2 %
:HMM:SCOP  297->435 1p3dA2 c.59.1.1 * 3.5e-38 47.5 %
:RPS:PFM   109->276 PF08245 * Mur_ligase_M 4e-11 35.2 %
:RPS:PFM   310->371 PF02875 * Mur_ligase_C 2e-08 47.5 %
:HMM:PFM   109->277 PF08245 * Mur_ligase_M 1.5e-27 29.2 168/188  
:HMM:PFM   298->379 PF02875 * Mur_ligase_C 1e-21 36.6 82/91  
:HMM:PFM   8->102 PF01225 * Mur_ligase 5.4e-16 32.9 70/76  
:BLT:SWISS 1->443 MURC_LACS1 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99294.1 GT:GENE murC GT:PRODUCT UDP-N-acetylmuramate--alanine ligase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 533809..535140 GB:FROM 533809 GB:TO 535140 GB:DIRECTION + GB:GENE murC GB:PRODUCT UDP-N-acetylmuramate--alanine ligase GB:NOTE COG0773 [M] UDP-N-acetylmuramate-alanine ligase GB:PROTEIN_ID ABD99294.1 GB:DB_XREF GI:90820655 GB:GENE:GENE murC LENGTH 443 SQ:AASEQ MNSEQTYFFVGIKGTGMSSLALILHDKGYKVLGSDIDKYTFTQRGLENAGIKILPFDEDNIKEDMIVVAGNAFGDDQVEIKKAHEMGLTVQTYPETVEQIIEETTSIGVAGAHGKTSTSGLLAHVLSGVSPTSYLVGDGSGKGTPNARFFVFEADEYRRHFVAYHPDYAIMTNIDFDHPDYFTDIDDVRDAFETLAMQTKKGIFVWGEDENLRKLNAKVPVHYYGTKSDDDFRAENIKRTTKGSNFDVYFHDEFIGNYDIPMFGEHNVLNSLAVIAVSYMEKVDQQEIAKELLTFKGVKRRFTEKRVADMVIIDDYAHHPAEIKATIDAARQQYPDKKIIAVFQPHTFSRTIALMDEFAESLSLADKVYLTDIFSSIREHDGKVSSEDLGKKISKGGEVLKLDNMSPLLDFHDDVVIFMGAGDIQKYEHAYEDLLSNLSLKNN GT:EXON 1|1-443:0| SW:ID MURC_LACS1 SW:DE RecName: Full=UDP-N-acetylmuramate--L-alanine ligase; EC=6.3.2.8;AltName: Full=UDP-N-acetylmuramoyl-L-alanine synthetase; SW:GN Name=murC; OrderedLocusNames=LSL_0485; SW:KW ATP-binding; Cell cycle; Cell division; Cell shape;Cell wall biogenesis/degradation; Complete proteome; Cytoplasm;Ligase; Nucleotide-binding; Peptidoglycan synthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->443|MURC_LACS1|0.0|100.0|443/443| GO:SWS:NREP 9 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0008360|"GO:regulation of cell shape"|Cell shape| GO:SWS GO:0007047|"GO:cellular cell wall organization"|Cell wall biogenesis/degradation| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0009252|"GO:peptidoglycan biosynthetic process"|Peptidoglycan synthesis| BL:PDB:NREP 1 BL:PDB:REP 24->426|1gqyB|2e-39|30.1|402/469| RP:PDB:NREP 1 RP:PDB:REP 17->422|2am1A|6e-56|14.4|395/442| RP:PFM:NREP 2 RP:PFM:REP 109->276|PF08245|4e-11|35.2|159/187|Mur_ligase_M| RP:PFM:REP 310->371|PF02875|2e-08|47.5|61/84|Mur_ligase_C| HM:PFM:NREP 3 HM:PFM:REP 109->277|PF08245|1.5e-27|29.2|168/188|Mur_ligase_M| HM:PFM:REP 298->379|PF02875|1e-21|36.6|82/91|Mur_ligase_C| HM:PFM:REP 8->102|PF01225|5.4e-16|32.9|70/76|Mur_ligase| GO:PFM:NREP 5 GO:PFM GO:0005524|"GO:ATP binding"|PF08245|IPR013221| GO:PFM GO:0009058|"GO:biosynthetic process"|PF08245|IPR013221| GO:PFM GO:0005524|"GO:ATP binding"|PF02875|IPR004101| GO:PFM GO:0009058|"GO:biosynthetic process"|PF02875|IPR004101| GO:PFM GO:0016874|"GO:ligase activity"|PF02875|IPR004101| RP:SCP:NREP 3 RP:SCP:REP 9->91|1j6uA1|2e-19|35.4|82/89|c.5.1.1| RP:SCP:REP 102->296|1j6uA3|6e-32|28.2|188/207|c.72.2.1| RP:SCP:REP 297->437|1gqqA2|6e-26|32.6|141/154|c.59.1.1| HM:SCP:REP 4->92|1j6uA1|1.4e-20|40.9|88/0|c.5.1.1|1/1|MurCD N-terminal domain| HM:SCP:REP 89->296|1j6uA3|3e-58|38.2|199/0|c.72.2.1|1/1|MurD-like peptide ligases, catalytic domain| HM:SCP:REP 297->435|1p3dA2|3.5e-38|47.5|139/0|c.59.1.1|1/1|MurD-like peptide ligases, peptide-binding domain| OP:NHOMO 1335 OP:NHOMOORG 881 OP:PATTERN --------------------------------11-------------------1-------------- 2331111111111111111-111111111111111111111112111111111111111111-1111111111111111111111111111121111--312222222221111111212111112222232222211111---111111111111111121111211111111111111111111111112121121212211221221222233122113111233323422222222222222221222112121121222111111113111111222111111111111111111111111111111112211122211322122222222221211111112212112111121122312113112112-111211111111111111111111111111111-111111111111111111111111111211111211111111111111111121121--------111111111111111111112112122222222222222222222222222222222222222222222222222222222222232222222222222221111111111111111111222222121111111111111111111112111222222222222222222222222232222321-12222-1-11122222222222222222-22222222222222222222222222222212222222222122222222221222222222222111211111222222221222222222222222222222222222222222222222222222333223332222222222222222222222222222211212222221112111111--------------------------1112111111222 -----------------------1-11----------------------------------------------------------------------------------------------------------------------------------------1---------1----1------1--1--2--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 429 STR:RPRED 96.8 SQ:SECSTR ########EEccccHHHHHHHHHHTcccccTTccccccccEEccGccccccccGGGHHHHHHHTccEEEEccccccccEEEcccHHHHHHHHEEHHHHHHHHccEEEEEEcccccccHHHHHHHHTTTccEEEccTTcccTTHHHTccEEEEEccccTTHHHHHcccEEEEccccccccTTcccHHHHHHHHGGGTTcTTcEEEEEccGGGGGGcccccEEEEEcccTTccccEEEEEEccccEEEEETTcETTccEEEEccccHHHHHHHHHHHHHHHTTTccHHHHHHHGGGcccccccccEEccTTTcEEEEcccccHHHHHHHTTcccccccEEEEEEEcccccTTHHHHHHHGGGccTTccEEEEEEcTTHHHHHHHHHccTTcEETccEEEccccccTHHHHHHHTTEEEEEEcccTccHHHHHHHHHHTc###### DISOP:02AL 1-3,441-444| PSIPRED cccccEEEEEEEccccHHHHHHHHHHcccEEEEEEccccHHHHHHHHHcccEEEEEcHHHcccccEEEEccccccccHHHHHHHHccccEEcHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHccccEEEEccccccccccEEEEEEEEccccccccEEEEEEEEEccccHHHHHHcccHHHHHHHHHHHHHcccccEEEEcccHHHHHHHccccEEEEEEcccccEEEEEEEEcccEEEEEEEEccEEEEEEEEccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccEEEEEEccEEEEEEccccHHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHHHHccEEEEEcccccccccHHHccHHHHHHHHHccccHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHHcccc //