[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : murG
DDBJ      :murG         UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
Swiss-Prot:MURG_LACS1   RecName: Full=UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase;         EC=2.4.1.227;AltName: Full=Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase;

Homologs  Archaea  0/68 : Bacteria  852/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
c.87.1
:365 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->355 1nlmA PDBj 2e-30 28.7 %
:RPS:PDB   2->360 3d0qA PDBj 3e-29 14.2 %
:RPS:SCOP  2->363 1f0kA  c.87.1.2 * 1e-69 25.1 %
:HMM:SCOP  1->366 1f0kA_ c.87.1.2 * 2.6e-105 39.3 %
:RPS:PFM   3->140 PF03033 * Glyco_transf_28 1e-19 36.6 %
:RPS:PFM   190->335 PF04101 * Glyco_tran_28_C 1e-23 36.1 %
:HMM:PFM   4->142 PF03033 * Glyco_transf_28 9.8e-39 36.3 135/139  
:HMM:PFM   189->354 PF04101 * Glyco_tran_28_C 9e-39 31.7 164/167  
:BLT:SWISS 1->365 MURG_LACS1 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99858.1 GT:GENE murG GT:PRODUCT UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1074314..1075411) GB:FROM 1074314 GB:TO 1075411 GB:DIRECTION - GB:GENE murG GB:PRODUCT UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase GB:NOTE COG0707 [M] UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase GB:PROTEIN_ID ABD99858.1 GB:DB_XREF GI:90821219 GB:GENE:GENE murG LENGTH 365 SQ:AASEQ MRLLISGGGTGGHIYPALALIEAIKQKEPDSEILYVGTHKGLESRIVPSAGVPLKTIKIQGFKRSLSLENFKTVYLFLKSVHDCKKIIRDFKPDVVVGTGGYVCGAVVYAAARMKIPTFVHEQNSVAGVTNKFLSRFVDKVGICFEDARKDFPASKVVFTGNPRAQQVAGMKDTGRLEKEYKLRKDLPTVMIFGGSRGAEGINAAALKAIPQFAKKEYQVLFVTGKVHYDKIMAKDEAKNLPDNVRIEPYIADMPAILPEVASIVGRAGATSLAEITALGIPTILIPSPYVTNDHQTKNAMSLVNKDAALMIKEKDLTADILVKNVDKIMNDSDKRLQMGKNAKEAGIPDAANQVIKVLEDIMHK GT:EXON 1|1-365:0| SW:ID MURG_LACS1 SW:DE RecName: Full=UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase; EC=2.4.1.227;AltName: Full=Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase; SW:GN Name=murG; OrderedLocusNames=LSL_1050; SW:KW Cell cycle; Cell division; Cell membrane; Cell shape;Cell wall biogenesis/degradation; Complete proteome;Glycosyltransferase; Membrane; Peptidoglycan synthesis; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->365|MURG_LACS1|0.0|100.0|365/365| GO:SWS:NREP 9 GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0008360|"GO:regulation of cell shape"|Cell shape| GO:SWS GO:0007047|"GO:cellular cell wall organization"|Cell wall biogenesis/degradation| GO:SWS GO:0016757|"GO:transferase activity, transferring glycosyl groups"|Glycosyltransferase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0009252|"GO:peptidoglycan biosynthetic process"|Peptidoglycan synthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 95->112|vvvgtggyvcgavvyaaa| BL:PDB:NREP 1 BL:PDB:REP 2->355|1nlmA|2e-30|28.7|335/350| RP:PDB:NREP 1 RP:PDB:REP 2->360|3d0qA|3e-29|14.2|345/369| RP:PFM:NREP 2 RP:PFM:REP 3->140|PF03033|1e-19|36.6|134/138|Glyco_transf_28| RP:PFM:REP 190->335|PF04101|1e-23|36.1|144/162|Glyco_tran_28_C| HM:PFM:NREP 2 HM:PFM:REP 4->142|PF03033|9.8e-39|36.3|135/139|Glyco_transf_28| HM:PFM:REP 189->354|PF04101|9e-39|31.7|164/167|Glyco_tran_28_C| GO:PFM:NREP 7 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF03033|IPR004276| GO:PFM GO:0016758|"GO:transferase activity, transferring hexosyl groups"|PF03033|IPR004276| GO:PFM GO:0030259|"GO:lipid glycosylation"|PF03033|IPR004276| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF04101|IPR007235| GO:PFM GO:0016758|"GO:transferase activity, transferring hexosyl groups"|PF04101|IPR007235| GO:PFM GO:0030246|"GO:carbohydrate binding"|PF04101|IPR007235| GO:PFM GO:0030259|"GO:lipid glycosylation"|PF04101|IPR007235| RP:SCP:NREP 1 RP:SCP:REP 2->363|1f0kA|1e-69|25.1|347/351|c.87.1.2| HM:SCP:REP 1->366|1f0kA_|2.6e-105|39.3|351/0|c.87.1.2|1/1|UDP-Glycosyltransferase/glycogen phosphorylase| OP:NHOMO 905 OP:NHOMOORG 861 OP:PATTERN -------------------------------------------------------------------- 111-111111111111111-111111111111111111--11131-111111111111112211111112111111111111111111111111111--11111111111111111111111111111111111111--22---1--11111111111111111111111111111111111111---11111122222322132233211221123311111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111112111111111111111111111111111111111121111111111111111-111111111111111111111111111111111-11111-11111111111111111111111111111111111111111-111111111--------1111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111-1111111-11111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-11111111111111111111--------------------------1111111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1-11-8-----1--1-12------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 365 STR:RPRED 100.0 SQ:SECSTR cEEEEEccccTTccHHHHHHHHHHHHTTcEcEEEccTTccHHHHHHHHHHHcTTTTTTGGGcccccGGGGHHHHHHHHGGGHHHHHHHHHHcccEEEEETTcHHHHHHHHHHTccEEEEcccccccTTHHHHHTTcHHHHHTTcccccccEccGGGcccccTTEEEccccccccccccccccccccccEEEEEcHHHHHHHccGGGHHHHHHHTTcccEEEEEcTTcccGGGcHcGGGccccTTEEEccccccHHHHHTTEEEEEEcccHHHHHHHHTHTccEEEcccTTccHHcTTcHHHHHHHHHHTcEEEccHcTTTccHHHHHHHHHcHHHHHHHHHHHHHHTcccHHHHHHHHHHHHTTc DISOP:02AL 339-348| PSIPRED cEEEEEEccccHHHHHHHHHHHHHHHccccEEEEEEEccccHHHHcccccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHcEEEEccHHHHcccccccEEEEcccccHHHHccccHHHHHHHccccccccEEEEEccccHHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHccccccEEEEEccccHHHHHHHccEEEEcccHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHcccEEEEcHHHccHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcc //