[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : nusB
DDBJ      :nusB         N utilization substance protein B
Swiss-Prot:NUSB_LACS1   RecName: Full=N utilization substance protein B homolog;         Short=Protein nusB;

Homologs  Archaea  0/68 : Bacteria  393/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.79.1
:131 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   51->130 1tzwA PDBj 5e-12 36.7 %
:RPS:PDB   4->130 3d3cA PDBj 4e-23 29.6 %
:RPS:SCOP  4->131 1tztA  a.79.1.1 * 1e-24 28.3 %
:HMM:SCOP  4->131 1eyvA_ a.79.1.1 * 1.5e-34 43.3 %
:RPS:PFM   51->130 PF01029 * NusB 3e-17 50.6 %
:HMM:PFM   7->130 PF01029 * NusB 1.3e-39 43.4 122/134  
:BLT:SWISS 1->131 NUSB_LACS1 3e-58 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99341.1 GT:GENE nusB GT:PRODUCT N utilization substance protein B GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 576129..576524 GB:FROM 576129 GB:TO 576524 GB:DIRECTION + GB:GENE nusB GB:PRODUCT N utilization substance protein B GB:NOTE COG0781 [K] Transcription termination factor GB:PROTEIN_ID ABD99341.1 GB:DB_XREF GI:90820702 GB:GENE:GENE nusB LENGTH 131 SQ:AASEQ MSLSRHDIRKIAFQTLFALGSNPDANSEDIYQELLDEDNNDSDLSYLNELVDGVLDHQSEIDMEITKYLRKNWNIGRLNKTDLIILRIAIFEIKYSDVASKIAVNEAVELAKEFSDDKSYKFVNAILQNLI GT:EXON 1|1-131:0| SW:ID NUSB_LACS1 SW:DE RecName: Full=N utilization substance protein B homolog; Short=Protein nusB; SW:GN Name=nusB; OrderedLocusNames=LSL_0532; SW:KW Complete proteome; Transcription; Transcription regulation;Transcription termination. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->131|NUSB_LACS1|3e-58|100.0|131/131| GO:SWS:NREP 3 GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| GO:SWS GO:0006353|"GO:transcription termination"|Transcription termination| SEG 33->50|elldednndsdlsylnel| BL:PDB:NREP 1 BL:PDB:REP 51->130|1tzwA|5e-12|36.7|79/142| RP:PDB:NREP 1 RP:PDB:REP 4->130|3d3cA|4e-23|29.6|125/138| RP:PFM:NREP 1 RP:PFM:REP 51->130|PF01029|3e-17|50.6|79/124|NusB| HM:PFM:NREP 1 HM:PFM:REP 7->130|PF01029|1.3e-39|43.4|122/134|NusB| GO:PFM:NREP 2 GO:PFM GO:0003723|"GO:RNA binding"|PF01029|IPR006027| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01029|IPR006027| RP:SCP:NREP 1 RP:SCP:REP 4->131|1tztA|1e-24|28.3|127/141|a.79.1.1| HM:SCP:REP 4->131|1eyvA_|1.5e-34|43.3|127/131|a.79.1.1|1/1|NusB-like| OP:NHOMO 394 OP:NHOMOORG 393 OP:PATTERN -------------------------------------------------------------------- --1-----11111--11--------------------------11----11-111--1----1111------111111-111--------------1-----1----------------------1-1--1-1111111111111-1111111-----------11-1111-----------------111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111-11-1111111111111111111111-11111-11111-1111111------1-11---------------------------------------------------------11---------------------------------------------------------1----------------------------------------------------------------------------1---11111111111111111-111111-11-111111111-11111111111111--1-1-------1-------1---------1--------------11-1-111111111-11-1111111111111111111111--1111111111111111111-11111111--------------1--11111------------------------------------------------------------------1---------------------------111111111111111111------------------1-------1-111111-11- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 98.5 SQ:SECSTR ##cHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccTTccHHHHHHHHHHHHTcHHHHHHHHGGGTTTccccccccHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHccTTHHHHHHHHHHHHT DISOP:02AL 1-3| PSIPRED ccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHc //