[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : nusG
DDBJ      :nusG         Transcription antitermination protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  898/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
b.34.5d.58.42
:186 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->42,69->185 1nppB PDBj 4e-20 40.4 %
:RPS:PDB   69->185 2ckkA PDBj 4e-22 10.0 %
:RPS:SCOP  10->122 1nz8A  d.58.42.1 * 1e-26 39.1 %
:RPS:SCOP  133->185 1m1gA2  b.34.5.4 * 3e-15 47.2 %
:HMM:SCOP  9->122 1nz8A_ d.58.42.1 * 2.7e-34 56.8 %
:HMM:SCOP  128->185 1m1gA2 b.34.5.4 * 3.7e-17 51.7 %
:RPS:PFM   11->112 PF02357 * NusG 1e-21 52.7 %
:HMM:PFM   10->111 PF02357 * NusG 1.3e-27 54.7 86/92  
:HMM:PFM   134->165 PF00467 * KOW 2.3e-09 43.3 30/32  
:HMM:PFM   103->125 PF04428 * Choline_kin_N 0.001 39.1 23/53  
:BLT:SWISS 8->185 NUSG_BACSU 2e-51 60.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00048.1 GT:GENE nusG GT:PRODUCT Transcription antitermination protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1273402..1273962) GB:FROM 1273402 GB:TO 1273962 GB:DIRECTION - GB:GENE nusG GB:PRODUCT Transcription antitermination protein GB:NOTE COG0250 [K] Transcription antiterminator GB:PROTEIN_ID ABE00048.1 GB:DB_XREF GI:90821409 GB:GENE:GENE nusG LENGTH 186 SQ:AASEQ MAHTVESVEKKWYVLHTYAGYENKVKENLESRATSMGMEDYIFRVVVPEEEKHETTKTGKEKVEKLKTFPGYVLVEMVMTDQSWYVVRNTPGVTGFVGSHGSGSKPAPLLDEEINHILHELGISSRHSNFDAEVGDAVTIIDGAFSGLVGKITEIDTEKMKLKVDIDMFGRETAAELNYDQVDKLV GT:EXON 1|1-186:0| BL:SWS:NREP 1 BL:SWS:REP 8->185|NUSG_BACSU|2e-51|60.5|177/177| SEG 45->68|vvvpeeekhettktgkekveklkt| BL:PDB:NREP 1 BL:PDB:REP 8->42,69->185|1nppB|4e-20|40.4|149/241| RP:PDB:NREP 1 RP:PDB:REP 69->185|2ckkA|4e-22|10.0|110/120| RP:PFM:NREP 1 RP:PFM:REP 11->112|PF02357|1e-21|52.7|91/92|NusG| HM:PFM:NREP 3 HM:PFM:REP 10->111|PF02357|1.3e-27|54.7|86/92|NusG| HM:PFM:REP 134->165|PF00467|2.3e-09|43.3|30/32|KOW| HM:PFM:REP 103->125|PF04428|0.001|39.1|23/53|Choline_kin_N| GO:PFM:NREP 2 GO:PFM GO:0003711|"GO:transcription elongation regulator activity"|PF02357|IPR006645| GO:PFM GO:0032968|"GO:positive regulation of RNA elongation from RNA polymerase II promoter"|PF02357|IPR006645| RP:SCP:NREP 2 RP:SCP:REP 10->122|1nz8A|1e-26|39.1|110/119|d.58.42.1| RP:SCP:REP 133->185|1m1gA2|3e-15|47.2|53/58|b.34.5.4| HM:SCP:REP 9->122|1nz8A_|2.7e-34|56.8|111/0|d.58.42.1|1/1|N-utilization substance G protein NusG, N-terminal domain| HM:SCP:REP 128->185|1m1gA2|3.7e-17|51.7|58/58|b.34.5.4|1/1|Translation proteins SH3-like domain| OP:NHOMO 907 OP:NHOMOORG 901 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111-1111111111111111111111111111111111211111111111111111111--1-1111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111--111111-1-1111111111111111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------1-----2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 180 STR:RPRED 96.8 SQ:SECSTR ####TTccccEEEEEEEcTTcHHHHHHHHHHHHHHHTcGGGEcEEEccEEEEEEEcccccEEEEEEEcccTTcEEEEcccTTcGGGTTcEEEEEEEETE#TTEEEEEETTTccEEEEEGGGEEEcccccccccTTcEEEEcccTTTTcEEEEEEEEGGGTEEEEEcccTTTTcEEEEEGGGEEEc# DISOP:02AL 1-6,52-62| PSIPRED cccccccccccEEEEEEccccHHHHHHHHHHHHHHccccccccEEEEccHHHHHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHccccccEEEEccccccccccccHHHHHHHHHHccccccccccccccccEEEEEEcccccccEEEEEEcccccEEEEEEEEccccEEEEEcHHHHEEcc //