[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : oppB
DDBJ      :oppB         Oligopeptide transport system permease protein
Swiss-Prot:             

Homologs  Archaea  56/68 : Bacteria  796/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
a.183.1f.58.1
:311 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  14->55 1nt2B  a.183.1.1 * 7e-04 17.5 %
:RPS:SCOP  94->296 2onkC1  f.58.1.1 * 8e-12 13.4 %
:RPS:PFM   115->303 PF00528 * BPD_transp_1 5e-08 25.4 %
:HMM:PFM   112->303 PF00528 * BPD_transp_1 3.8e-44 32.2 183/185  
:BLT:SWISS 1->304 OPPB_BACSU 1e-71 43.8 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00500.1 GT:GENE oppB GT:PRODUCT Oligopeptide transport system permease protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1778158..1779093) GB:FROM 1778158 GB:TO 1779093 GB:DIRECTION - GB:GENE oppB GB:PRODUCT Oligopeptide transport system permease protein GB:NOTE COG0601 [EP] ABC-type dipeptide/oligopeptide/nickel transport systems, permease components GB:PROTEIN_ID ABE00500.1 GB:DB_XREF GI:90821861 GB:GENE:GENE oppB LENGTH 311 SQ:AASEQ MRKYLLKRVLYMLLTLFLVATITFFLMKLMPGTPYTNQAKMTASQIEIMNKQYGLDKPIWEQYLIYIFGMFHGDFGTSFQYSNQPVAYLISSRLGASMQLGLQAMIFGVFFGVILGAAAAIKHNTWADTGATVIAIIGKSVPNFVLAILLQYYIALKLGWFPIAGWGQFSNTILPTIALGVGPLAETARFIRTSMVEVLNSDYIELAKAKGLSKFEVVYHHALRNSLIPLVTLLGPYTVALMTGSMVIENIFNIPGIGEQFVKSIMTNDYPTIMGVTMVFSIGLVVVILITDIIYGLIDPRIRLEGNGGNK GT:EXON 1|1-311:0| BL:SWS:NREP 1 BL:SWS:REP 1->304|OPPB_BACSU|1e-71|43.8|304/311| TM:NTM 5 TM:REGION 9->31| TM:REGION 99->121| TM:REGION 134->156| TM:REGION 226->248| TM:REGION 276->298| RP:PFM:NREP 1 RP:PFM:REP 115->303|PF00528|5e-08|25.4|189/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 112->303|PF00528|3.8e-44|32.2|183/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 2 RP:SCP:REP 14->55|1nt2B|7e-04|17.5|40/236|a.183.1.1| RP:SCP:REP 94->296|2onkC1|8e-12|13.4|201/252|f.58.1.1| OP:NHOMO 3682 OP:NHOMOORG 858 OP:PATTERN 4441314266665564453332113336435212---1-----113-52-EA5-54432133314-11 -113D443444-4122222-22112A2222224333397A18197EB536648C732611552395988A43333733323-411111--------2--------11--122222222222222211111111121465952216A3322333221111111132215322111111111111A5433A91423666664564546445A76663655314C521222222E6155545555655556333322222342-12111--33111112234333333311112211111112222222222222231122211111C36244434541422222111153153C-111BA641-282-3462174311----1121132HHO115854B19AAA9AA8AAL-44C43A4DQP1-mRRXJJEXUMOPK4-116CEB7BB7DG1111111123322219-------------------------------11--CFBCC68888654555559955552567E64A7113342363353D5DS241142242-------111221346132362233331111111211----13111111--111-122222212214-1211663121111151111111211111121121--13321------76KE4987777777777-7777777777777676776BCCCA3366666666666666666976666674-666666656666--111111111111174844412333212423222222121235333233658265442ABA1----1---246666666656688--1-------------12112222222122126-111211-212221122212212211143854BEA89212 -----------------------------------------------------------------------------------------------------------------1--------------------------------------------2----3---------1-----------1--1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 302-312| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEcccccccc //