[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : oppD
DDBJ      :oppD         Oligopeptide transport ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:347 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   20->260 2it1B PDBj 2e-35 35.6 %
:RPS:PDB   3->259 3dmdC PDBj 6e-46 13.3 %
:RPS:SCOP  5->260 1b0uA  c.37.1.12 * 4e-52 31.0 %
:HMM:SCOP  33->340 1a7jA_ c.37.1.6 * 6e-72 37.5 %
:RPS:PFM   55->184 PF00005 * ABC_tran 8e-15 41.5 %
:RPS:PFM   235->293 PF08352 * oligo_HPY 6e-09 45.8 %
:HMM:PFM   52->184 PF00005 * ABC_tran 2.9e-22 27.8 115/118  
:HMM:PFM   235->296 PF08352 * oligo_HPY 1.6e-20 46.8 62/64  
:HMM:PFM   27->60 PF01580 * FtsK_SpoIIIE 2.2e-06 38.2 34/205  
:BLT:SWISS 4->344 OPPD_BACSU e-120 62.8 %
:PROS 156->170|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00498.1 GT:GENE oppD GT:PRODUCT Oligopeptide transport ATP-binding protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1776076..1777119) GB:FROM 1776076 GB:TO 1777119 GB:DIRECTION - GB:GENE oppD GB:PRODUCT Oligopeptide transport ATP-binding protein GB:NOTE COG0444 [EP] ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component GB:PROTEIN_ID ABE00498.1 GB:DB_XREF GI:90821859 GB:GENE:GENE oppD LENGTH 347 SQ:AASEQ MAERILDVKNLKVDFHTYAGEVKAIRDVSFHLDKGETLAIVGESGSGKSVTTKAIIGLLANNAKVVGGEINFNGQDILKKSEKEMQSVRGKEISMIFQDPMTSLDPTMKIGQQIAEPLMKHKGMNKKDAWAKALDMLKAVGITNAEKRINDYPHQFSGGMRQRIVIAIALVCDPEILIADEPTTALDVTVQAQILDLMKEMQAKVKTSIIFITHDLGVVAGMADRVAVMYAGELLEYGTVDEVFYNPQHPYTWGLLNSMPTLASDKLESIPGTPPDLLDPPKGDPFAPRNPYAMKIDAEQKPPFFKVSDTHYAATWLLHPDAPKVTPPEEIVRRQEKYTELMAKKKD GT:EXON 1|1-347:0| BL:SWS:NREP 1 BL:SWS:REP 4->344|OPPD_BACSU|e-120|62.8|341/358| PROS 156->170|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 271->285|pgtppdlldppkgdp| BL:PDB:NREP 1 BL:PDB:REP 20->260|2it1B|2e-35|35.6|225/361| RP:PDB:NREP 1 RP:PDB:REP 3->259|3dmdC|6e-46|13.3|226/318| RP:PFM:NREP 2 RP:PFM:REP 55->184|PF00005|8e-15|41.5|118/123|ABC_tran| RP:PFM:REP 235->293|PF08352|6e-09|45.8|59/64|oligo_HPY| HM:PFM:NREP 3 HM:PFM:REP 52->184|PF00005|2.9e-22|27.8|115/118|ABC_tran| HM:PFM:REP 235->296|PF08352|1.6e-20|46.8|62/64|oligo_HPY| HM:PFM:REP 27->60|PF01580|2.2e-06|38.2|34/205|FtsK_SpoIIIE| GO:PFM:NREP 5 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| GO:PFM GO:0000166|"GO:nucleotide binding"|PF08352|IPR013563| GO:PFM GO:0005524|"GO:ATP binding"|PF08352|IPR013563| GO:PFM GO:0015833|"GO:peptide transport"|PF08352|IPR013563| RP:SCP:NREP 1 RP:SCP:REP 5->260|1b0uA|4e-52|31.0|245/258|c.37.1.12| HM:SCP:REP 33->340|1a7jA_|6e-72|37.5|283/0|c.37.1.6|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 47288 OP:NHOMOORG 1173 OP:PATTERN TTN8RGMJVVXVVRYOkKOPLPLTtPSfnRbRJCEDDCHHIGDUXTUnKQ**l9ScSWXNVMKIX18B TbjH*ebajjkSaPXKOML-Lc88S*MMMMMKpgehq***N*R*l*wbqldN*wsNSlABqwqe*jv***bZbbbsaYYM*diBBDACPORL5NGHK--DFULNLWNVKT9AAAAAABDCBBBBITPKTYKLPSYPdllt*LKJzTqijuggiehRTKIMELIbeVe***ZJMIJJILNHJGHgXXLJulAWdy************************hkt**hnzzyyvw**Zllklkhkijlllijdhccc*dcY**YQbXivuRR**YUSXkkiilqptwwq*wvvsyutmovwsttcccbbcdgfdbbcynmjiepoqkl***********j*ls***ciid*uiyv*ipQL**qjVcgoTYkerkOfXVLYTTTIJLKKLbW***RUp****************-jn*hd*g***TB**************HHG**********LKLLLLLLlTXFOca*55545444655557BB6776576687575KDAEFB***z*******yyxzt********h********ALvvn*eqin*v****bobQUKSmTGHGHIGGQMNWjeb**OdSvjQbrUTnHaaYSRXeVbNNQNixV*MMMSGLLKOKJADAAABAAAGTHIIJJmnpNtSbLUPyPSUVTOWdVTTQRUbWTcb5-CJUQK321333****Z*x*********z-*************xyzyxw*****jlmnoklonnmommlnllk*toqvvvxT5************33LJFGDEFIJKJOH*m*dedbbaJPSPOTRVfLNPPNFOIQUmYuusts***r**suc***FEECDFEDEMjtt*ttuut*****OOMKMLKIJIECDC77JUUUKKLJBA89899A*BYEDFCB-GCFEKIFFFECGKEEGBBBZjwXWs*qpnDZM 1122abE-YG69WcLFBD88GKHPESHGG9A89KHGADBBCDDBAAHGKQJIULGGE99DBD99D47617768AB8816987866A44-HJ5BCBBE9BB959IFF1JabsOTNXVYGB97FTDoh6*C**h4gQbFHFAbAGcM9KCBAW89*DUQPjHd*HlRO7*Wf*WeSHBJHE*AD9AJnVX*7zeFKvfmiD ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,339-340,343-348| PSIPRED ccccEEEEEccEEEEEcccEEEEEEccccEEEccccEEEEEEcccccHHHHHHHHHHHcccccEEEEEEEEEccEEHHcccHHHHHHHHHHHEEEEEccHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHccccccccHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHHHHHHHHHcccEEEEEcHHHHHHccccHHHHHHHHHcccccHHHccccccccHHHcccccccccccccHHHHHHHcccccccEEEccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHccc //