[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : pepQ.1
DDBJ      :pepQ         Xaa-Pro aminopeptidase
Swiss-Prot:             

Homologs  Archaea  67/68 : Bacteria  874/915 : Eukaryota  194/199 : Viruses  0/175   --->[See Alignment]
c.55.2d.127.1
:367 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->359 1pv9A PDBj 5e-54 36.0 %
:RPS:PDB   2->364 1chmA PDBj 2e-73 21.7 %
:RPS:SCOP  4->136 1chmA1  c.55.2.1 * 1e-24 20.9 %
:RPS:SCOP  138->366 1chmA2  d.127.1.1 * 3e-56 22.3 %
:HMM:SCOP  1->136 1chmA1 c.55.2.1 * 3.2e-31 30.3 %
:HMM:SCOP  88->360 1b6aA2 d.127.1.1 * 2.5e-73 35.2 %
:RPS:PFM   149->347 PF00557 * Peptidase_M24 1e-37 41.4 %
:HMM:PFM   147->348 PF00557 * Peptidase_M24 9.8e-58 40.7 199/203  
:HMM:PFM   4->138 PF01321 * Creatinase_N 1.4e-23 27.3 128/131  
:BLT:SWISS 3->366 PEPQ_LACHE e-120 56.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99229.1 GT:GENE pepQ.1 GT:PRODUCT Xaa-Pro aminopeptidase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(462226..463329) GB:FROM 462226 GB:TO 463329 GB:DIRECTION - GB:GENE pepQ GB:PRODUCT Xaa-Pro aminopeptidase GB:NOTE COG0006 [E] Xaa-Pro aminopeptidase GB:PROTEIN_ID ABD99229.1 GB:DB_XREF GI:90820590 GB:GENE:GENE pepQ LENGTH 367 SQ:AASEQ MKHIEEVQEWLANNNLDIAYISDFHNIRYYTGFDSDPIERILALFIFPDKDPFIFAPALEVGSVKESGWEYPVFGYLDHEDAFALIKSHINALAGNPKKWAVEKDNLTVAKSEAILRNFPEAKFVENISPFINKQRSIKNEDEINLLLEAGKWADYAFKVGFDALSTNKTEQAVAAEIEYELKKKGVMHMSFDTIIQSGANAADPHGAPKEDTIKPNELTLFDLGTVYKGYISDASRTVAFGEIDDKLKDIYNVCLEAQLTAQNAAKPGMTAEELDKIARDVITKAGYGEYFIHRLGHGMGQSEHEFPSIMEGNKMELVPGMCFSIEPGIYIPNYAGVRIEDCVYVTDNGVKPFTHTSKELQIIPLS GT:EXON 1|1-367:0| BL:SWS:NREP 1 BL:SWS:REP 3->366|PEPQ_LACHE|e-120|56.0|364/368| BL:PDB:NREP 1 BL:PDB:REP 9->359|1pv9A|5e-54|36.0|333/337| RP:PDB:NREP 1 RP:PDB:REP 2->364|1chmA|2e-73|21.7|359/401| RP:PFM:NREP 1 RP:PFM:REP 149->347|PF00557|1e-37|41.4|198/203|Peptidase_M24| HM:PFM:NREP 2 HM:PFM:REP 147->348|PF00557|9.8e-58|40.7|199/203|Peptidase_M24| HM:PFM:REP 4->138|PF01321|1.4e-23|27.3|128/131|Creatinase_N| GO:PFM:NREP 1 GO:PFM GO:0009987|"GO:cellular process"|PF00557|IPR000994| RP:SCP:NREP 2 RP:SCP:REP 4->136|1chmA1|1e-24|20.9|129/155|c.55.2.1| RP:SCP:REP 138->366|1chmA2|3e-56|22.3|229/246|d.127.1.1| HM:SCP:REP 1->136|1chmA1|3.2e-31|30.3|132/0|c.55.2.1|1/1|Creatinase/prolidase N-terminal domain| HM:SCP:REP 88->360|1b6aA2|2.5e-73|35.2|270/296|d.127.1.1|1/1|Creatinase/aminopeptidase| OP:NHOMO 2759 OP:NHOMOORG 1135 OP:PATTERN 11111122222222221222222112221141111112111113321111222132332331112-11 2353322222223123222-22112422222223332223---11-22---111221--1212-222343-1111--12232311122444313222--1121311111112222221222222322112111221433242223211211121112221222111211212111222121223223322232355555555355555543333355634544322222226422222222222222222222222323322222222331212322221122122222222222222222222222222222222222222214326666767745436224555223114232244441322432221321313111311111113332221212111221221226-11211112591144422243323332232156232243411111111---21211111111111111222212222222211115234312222234444324444444655555545512221122112-11122-2111122225222222222211122432322223222133332424332222-132211222222211121211122112222222513534244222233533324253245--13111-1----31211212222222222-22222222222222222221211121212111111111111113222111111334344333444---1111113333113331111111111-11113333422--11222324523455562233111111111211111111122211112111111122221113221122-11111111-2-1111-12122112221121111111131122222111 2212453-62114443331233323142243333333433133433554433431131323333433334433433333334443423-46534544444423A78132374745481121252851618c5-665141263454321236116254434754645-657A42653122Y433124785254-222231 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 367 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHHHHHHTTccEEEEccHHHHHHHHccccccTTcccEEEEccccEEEEEEGGGTTHHHHHcEcccEEEEEcTTcTTHHHHHHHHHHHcccccEEEEcTTTccHHHHHHHHHHcTTcEEEEccHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHHHHccTTccHHHHHHHHHHHHHHHHccccccEEEEEEGGGGGcTTcccccccccTTcEEEEEEEcEETTEEccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHccTTccHHHHHHHHHHHHHHHTcGGGcccccccccccEETTEEcccTTccccccTTcEEEEccEEEEcTTEEEEccEEEEEETTEEEEcccccccHHHHEEc DISOP:02AL 1-1| PSIPRED cHHHHHHHHHHHHccccEEEEccHHHHHHHcccccccccccEEEEEcccccEEEEEEcccHHHHHHHHccccEEEEcccccHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHcccccEEccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccEEEEEccccccccccccccccccccEEEEEEEEEEccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccccccccccccccEEcccccEEEcccEEEEEccccEEcccEEEEEEEEEEEcccccEEccccccEEEEEccc //