[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : pncA
DDBJ      :pncA         Pyrazinamidase / Nicotinamidase
Swiss-Prot:             

Homologs  Archaea  44/68 : Bacteria  173/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
c.33.1
:182 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->182 3hb7F PDBj 4e-15 33.5 %
:RPS:PDB   3->181 3eefA PDBj 6e-30 24.8 %
:RPS:SCOP  4->181 1nf8A  c.33.1.3 * 3e-35 19.2 %
:HMM:SCOP  1->181 1nbaA_ c.33.1.3 * 2.6e-46 35.8 %
:RPS:PFM   4->181 PF00857 * Isochorismatase 2e-23 40.5 %
:HMM:PFM   4->178 PF00857 * Isochorismatase 7.4e-39 33.3 165/174  
:BLT:SWISS 1->181 YUEJ_BACSU 2e-57 54.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00314.1 GT:GENE pncA GT:PRODUCT Pyrazinamidase / Nicotinamidase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1566617..1567165) GB:FROM 1566617 GB:TO 1567165 GB:DIRECTION - GB:GENE pncA GB:PRODUCT Pyrazinamidase / Nicotinamidase GB:NOTE COG1335 [Q] Amidases related to nicotinamidase GB:PROTEIN_ID ABE00314.1 GB:DB_XREF GI:90821675 GB:GENE:GENE pncA LENGTH 182 SQ:AASEQ MTKALLIIDYTNDFVDDKGVLTCGKPAQELEDYIVKTAQDFYSNGDYVILPTDTHFENDVFHPEHKLFPPHNIAGTWGQKLYGKLDEWYQEHQADEKVYQFAKNRYSAFQNTNLDNFLRERRIKDLYLVGVCTDICVLHTAIGGYNLNYQLTILKDGVATFTDNGQEWALEHFKNSLGATVE GT:EXON 1|1-182:0| BL:SWS:NREP 1 BL:SWS:REP 1->181|YUEJ_BACSU|2e-57|54.7|181/183| BL:PDB:NREP 1 BL:PDB:REP 4->182|3hb7F|4e-15|33.5|167/179| RP:PDB:NREP 1 RP:PDB:REP 3->181|3eefA|6e-30|24.8|161/168| RP:PFM:NREP 1 RP:PFM:REP 4->181|PF00857|2e-23|40.5|168/173|Isochorismatase| HM:PFM:NREP 1 HM:PFM:REP 4->178|PF00857|7.4e-39|33.3|165/174|Isochorismatase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00857|IPR000868| GO:PFM GO:0008152|"GO:metabolic process"|PF00857|IPR000868| RP:SCP:NREP 1 RP:SCP:REP 4->181|1nf8A|3e-35|19.2|167/207|c.33.1.3| HM:SCP:REP 1->181|1nbaA_|2.6e-46|35.8|173/253|c.33.1.3|1/1|Isochorismatase-like hydrolases| OP:NHOMO 245 OP:NHOMOORG 232 OP:PATTERN 11111111111111111111111111111111---------------------111111111111--- -----------------11-1-----1111---------------------------------------21-------1--111-111--------------------1------------------------------------2----------------------------------------1111-1-1--1-121111112112122221121111112------1-1111111111111111111111111111111111111111--1---1111111111111111111111111111111111111111---1-11-1---------11-----------1-------1------1----1-------------------------------------1---------11------------1------11-----------------------1---------------------------------------------------------------------------------1--------------------1------------1-----------1-------1-1---------------------------------------------------------------------------1------------------------------------11----------------------------------------------------1---------------------------------------------------------------------------------------------------------------1---1--------2-------11--1111111-- ----12-------------------------------------------1---------------1111--1---11111----------------------------------------------------------------------------------------------------11----------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 181 STR:RPRED 99.5 SQ:SECSTR #TEEEEEEccHHHHTcTccccTTccHHHHHHHHHHHHHHHHHHTTccEEEEEEcccTTcTTHHHHHHHHccccTTcGGGcccGGGccGccTTcccTTcEEEEEccccTTTTccHHHHHHHTTccEEEEEEEcTTTHHHHHHHHHHHTTcEEEEEEEEEEccccTTHHHHHHHHHHccEEEcH PSIPRED ccEEEEEEEccccEEcccccccccHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccccccccccccccHHcccccHHHHccHHHHHHHHHccccccEEEEcccccccccccHHHHHHHccccEEEEEEEcHHHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHHHHHccccc //