[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : potB
DDBJ      :potB         Spermidine/putrescine transport system permease protein
Swiss-Prot:             

Homologs  Archaea  31/68 : Bacteria  623/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:266 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->226 3fh6F PDBj 1e-08 28.2 %
:RPS:PDB   163->199 3dhwA PDBj 6e-10 32.4 %
:RPS:SCOP  27->240 2r6gG1  f.58.1.1 * 5e-18 18.6 %
:RPS:PFM   73->218 PF00528 * BPD_transp_1 5e-12 31.2 %
:HMM:PFM   57->258 PF00528 * BPD_transp_1 3.3e-14 21.0 162/185  
:BLT:SWISS 13->242 POTB_HAEIN 4e-40 34.9 %
:TM
:REPEAT 2|14->72|90->150
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98931.1 GT:GENE potB GT:PRODUCT Spermidine/putrescine transport system permease protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 131461..132261 GB:FROM 131461 GB:TO 132261 GB:DIRECTION + GB:GENE potB GB:PRODUCT Spermidine/putrescine transport system permease protein GB:NOTE COG1176 [E] ABC-type spermidine/putrescine transport system, permease component I GB:PROTEIN_ID ABD98931.1 GB:DB_XREF GI:90820292 GB:GENE:GENE potB LENGTH 266 SQ:AASEQ MKKINPLLTIPYYLWIGLFVIAPVLLIVYYSFIDIHGNFTLSNYGNYFGSGKYLMMTFNSFLYAFIITFFTVLVSYPMAYFLTKLKHKELWLLLVILPTWVNLLLKAYAFIGIFGIDGSVNHFLSFFGIGPKQILFTDFSFIVVATYIQIPFMIMPIFNALEEINPSVLRASRDLGANEWQTFFKVVMPLSMNGVKSGIQAVFIPSLSLFMLTRLIGGNRVITLGTAIEEHFLVTQNWGMGSTIGVVLIVIMFIVMVITGEKRGHK GT:EXON 1|1-266:0| BL:SWS:NREP 1 BL:SWS:REP 13->242|POTB_HAEIN|4e-40|34.9|229/286| TM:NTM 6 TM:REGION 9->31| TM:REGION 56->78| TM:REGION 93->115| TM:REGION 142->164| TM:REGION 201->223| TM:REGION 235->257| NREPEAT 1 REPEAT 2|14->72|90->150| SEG 244->258|igvvlivimfivmvi| BL:PDB:NREP 1 BL:PDB:REP 16->226|3fh6F|1e-08|28.2|209/316| RP:PDB:NREP 1 RP:PDB:REP 163->199|3dhwA|6e-10|32.4|37/203| RP:PFM:NREP 1 RP:PFM:REP 73->218|PF00528|5e-12|31.2|141/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 57->258|PF00528|3.3e-14|21.0|162/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 27->240|2r6gG1|5e-18|18.6|204/284|f.58.1.1| OP:NHOMO 1616 OP:NHOMOORG 656 OP:PATTERN --1-1-----------2-1111-122213-1-1--1-112221-------1-1--1-11111-1---- -11-2--1--1----------1---3------2111-----1---------------2----2-1--22111-111111---1---1-1111-1-----------1------------------11-1---21---21121--123112111223--------22122333--------------11111--2-21212223322221231111-2222333312222222851111111-111111-122114222111-22211111122-22323222211111112222222222211111111112112112221111-12134444344251332213312112231321221-112---1111-3----1111-------99A114222122233232-339-116115147J2-B88C57BCACDC94---349849AB57--------1----113-----------------------------1---2-355326556582244399DE67673584D2131--11142---33954F222-1--3111111-1212-111-4---311-3223121-1-1-1------2122--1------------------1----313-312--1-1222211111111122111------1------23421323333333333-333333342333333333343444-123333333333333333323222222-244444444444---1-----11112-41522233411111111211111---1111766657A7645452545111111111-21123233223122111111111-------1422----11111111-1211111-1121111-11121111111151341311111- --------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 211 STR:RPRED 79.3 SQ:SECSTR ###############HHHHTHHHHHHHHTTccccccccccccTTHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHccccccccTcccHHHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHTcHHHHHHHcccccccccc######################################## DISOP:02AL 1-2,262-267| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHEEccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccc //