[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : potD
DDBJ      :potD         Spermidine/putrescine-binding protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  557/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:361 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   41->342 1poy1 PDBj 1e-64 39.4 %
:RPS:PDB   38->357 1a99A PDBj 8e-51 30.6 %
:RPS:SCOP  39->358 1potA  c.94.1.1 * 3e-57 38.2 %
:HMM:SCOP  38->358 1a99A_ c.94.1.1 * 1.1e-92 36.8 %
:RPS:PFM   47->296 PF01547 * SBP_bac_1 1e-12 29.6 %
:HMM:PFM   52->295 PF01547 * SBP_bac_1 2.5e-22 24.4 234/314  
:BLT:SWISS 41->342 POTD_SALTY 3e-66 41.1 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98933.1 GT:GENE potD GT:PRODUCT Spermidine/putrescine-binding protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 133098..134183 GB:FROM 133098 GB:TO 134183 GB:DIRECTION + GB:GENE potD GB:PRODUCT Spermidine/putrescine-binding protein GB:NOTE COG0687 [E] Spermidine/putrescine-binding periplasmic protein GB:PROTEIN_ID ABD98933.1 GB:DB_XREF GI:90820294 GB:GENE:GENE potD LENGTH 361 SQ:AASEQ MKKLLALISGIIVIIVCLSLGVMRLNRTENTQTNSSSKKVLNIYNWGDYIDPQLIKKFEKQTGYKVNYETFDSNEAMFTKIKQGGTPYDIAVPSDYMIQKMAKEKLLLPLDKHKIKGMDNNDPQFLDLSFDKHNKYSVPYFWGTLGIVYNDKYIKPGEITNWNDLWNSKYRKQILFIDGAREFIGIGLNSLGYSLNSKNDSQINQAYDKLKNLTPNAKAFVADEIKTYMQNDEAPLAVTYSGEASEMLDNNSHLHYVIPDDGTNLWFDNIVIPKTAKNVKGAYEFINFMLEPKNAAQNAEYIGYATPNDKAAKLLPKSITSDRQFYPTKKQMSKMEVYADLGQTYLEKYNDDFLELKMYRQ GT:EXON 1|1-361:0| BL:SWS:NREP 1 BL:SWS:REP 41->342|POTD_SALTY|3e-66|41.1|302/348| TM:NTM 1 TM:REGION 4->25| BL:PDB:NREP 1 BL:PDB:REP 41->342|1poy1|1e-64|39.4|302/323| RP:PDB:NREP 1 RP:PDB:REP 38->357|1a99A|8e-51|30.6|320/341| RP:PFM:NREP 1 RP:PFM:REP 47->296|PF01547|1e-12|29.6|247/282|SBP_bac_1| HM:PFM:NREP 1 HM:PFM:REP 52->295|PF01547|2.5e-22|24.4|234/314|SBP_bac_1| GO:PFM:NREP 2 GO:PFM GO:0005215|"GO:transporter activity"|PF01547|IPR006059| GO:PFM GO:0006810|"GO:transport"|PF01547|IPR006059| RP:SCP:NREP 1 RP:SCP:REP 39->358|1potA|3e-57|38.2|319/322|c.94.1.1| HM:SCP:REP 38->358|1a99A_|1.1e-92|36.8|321/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 1009 OP:NHOMOORG 573 OP:PATTERN 11--------------1-11111--------------------------------------------- -11-2----------------1---3------1111----11-1------------------2-1--4221-----------1-----1111-1------------------------------1-----------44411---1211211112211------11112223--------------111----1-111111111111111--111-111122111111111121111111111111111111112112111-11111111111-11211111111111111111111111111111111111111111121111--111111111111111--11111-1111111-11-1-----------1----1111------11121111111122222122226-1111-1123E1-42231152324533----11314443211111111111--211---------------------------------1-11111333534122323362444523833--11-----21----233-5111----433333333111-1-1-4--131--21121-------2------2-----------------------------222-313---11111121111111121131------1------22112212223223222-222223322222222222233322--12222222222222222122222221-111111111111---------11111-612111222222222223--------111-99889BC7699773333111111111-222244444233331111111----------111----11111111-1211111---1--------1-------1--111-111-2- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1---------------------1112-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 352 STR:RPRED 97.5 SQ:SECSTR #EEccccccccHHHHccTTccc########EEEccccccEEEEEEETTcccTTHHHHHHHHHccEEEEEEEccHHHHHHHHHHccccccEEcccHHHHHHHHHTTccccccGGGcGGGGGccHHHHHHTTcGGGccEEEEEEEEEEEEEEHHHHHTccTTcTHHHHcHHHHHHHEEcccHHHHHHHHHHHTTccTTccHHHHHTHHHHHHHHHGGGccEEcccTHHHHHHTTcccEEEEEHHHHHHHHHHHHHHEEEccTTcEEEEEEEEEccTTcccHHHHHHHHHHHHcHHHHHHHHHHHccEEccTTTGGGccHHHHTcTTTcccHHHHTTEEccccccHHHHHHHHHHHHHHHHTcc DISOP:02AL 1-1,30-34,361-362| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHcccccEEEEEEccccccHHHHHHHHHHHccEEEEEEcccHHHHHHHHHccccccEEEEEcHHHHHHHHHccccccccHHHcccHHHccHHHHHcccccccEEEEEEEEEEEEEEEEHHHccccccccHHHHHcHHHcccEEEcccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccEEccHHHHHHHHcccEEEEEEccHHHHHHHHccccEEEEEcccccEEEEEEEEEEcccccHHHHHHHHHHHccHHHHHHHHHHHccccccHHHHHHccHHHHHcccccccHHHHHccEEcccccHHHHHHHHHHHHHHHcccc //