[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : proB
DDBJ      :proB         Glutamate 5-kinase
Swiss-Prot:PROB_LACS1   RecName: Full=Glutamate 5-kinase;         EC=2.7.2.11;AltName: Full=Gamma-glutamyl kinase;         Short=GK;

Homologs  Archaea  8/68 : Bacteria  694/915 : Eukaryota  170/199 : Viruses  0/175   --->[See Alignment]
c.73.1
:267 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->265 2j5tD PDBj 2e-32 32.3 %
:RPS:PDB   10->262 2akoA PDBj 4e-32 31.3 %
:RPS:SCOP  10->264 2akoA1  c.73.1.3 * 3e-32 32.8 %
:HMM:SCOP  10->267 2akoA1 c.73.1.3 * 7.4e-63 38.8 %
:RPS:PFM   128->201 PF00696 * AA_kinase 5e-09 40.0 %
:HMM:PFM   10->243 PF00696 * AA_kinase 3e-40 30.3 218/243  
:BLT:SWISS 1->267 PROB_LACS1 e-129 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00414.1 GT:GENE proB GT:PRODUCT Glutamate 5-kinase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1698073..1698876) GB:FROM 1698073 GB:TO 1698876 GB:DIRECTION - GB:GENE proB GB:PRODUCT Glutamate 5-kinase GB:NOTE COG0263 [E] Glutamate 5-kinase GB:PROTEIN_ID ABE00414.1 GB:DB_XREF GI:90821775 GB:GENE:GENE proB LENGTH 267 SQ:AASEQ MENRNLQDAKRIVVKVGTSSLIRANGKINLQAIDELCYTLSGLVNEDKEVVLVSSGAVGVGLANMGLVQRPKQIPEQQALAAIGQSQLMTIYQQRFAMYSQKTSQILLTHDVLTYPESRENVLNTFNELLKWKVIPVVNENDTVAVDEMDHQTSFGDNDWLSAVVASGIDADLLIVLSDIDGLFNKNPKKYADANLISEVTEINEKITGAAGGTGSRFGTGGMATKIKAMDRMINEGRKAVLANGKRPSIIFEILNGKQIGTLFHKK GT:EXON 1|1-267:0| SW:ID PROB_LACS1 SW:DE RecName: Full=Glutamate 5-kinase; EC=2.7.2.11;AltName: Full=Gamma-glutamyl kinase; Short=GK; SW:GN Name=proB; OrderedLocusNames=LSL_1612; SW:KW Amino-acid biosynthesis; ATP-binding; Complete proteome; Cytoplasm;Kinase; Nucleotide-binding; Proline biosynthesis; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->267|PROB_LACS1|e-129|100.0|267/267| GO:SWS:NREP 7 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006561|"GO:proline biosynthetic process"|Proline biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 50->63|vvlvssgavgvgla| SEG 208->224|tgaaggtgsrfgtggma| BL:PDB:NREP 1 BL:PDB:REP 8->265|2j5tD|2e-32|32.3|254/365| RP:PDB:NREP 1 RP:PDB:REP 10->262|2akoA|4e-32|31.3|233/237| RP:PFM:NREP 1 RP:PFM:REP 128->201|PF00696|5e-09|40.0|70/244|AA_kinase| HM:PFM:NREP 1 HM:PFM:REP 10->243|PF00696|3e-40|30.3|218/243|AA_kinase| GO:PFM:NREP 1 GO:PFM GO:0008652|"GO:cellular amino acid biosynthetic process"|PF00696|IPR001048| RP:SCP:NREP 1 RP:SCP:REP 10->264|2akoA1|3e-32|32.8|238/241|c.73.1.3| HM:SCP:REP 10->267|2akoA1|7.4e-63|38.8|250/0|c.73.1.3|1/1|Carbamate kinase-like| OP:NHOMO 977 OP:NHOMOORG 872 OP:PATTERN ---------------------------111-1-----------------1111--------------- -1-1111111111111111-111111111111111111111111-11-1--1111111--111111111111111111--11-11111111111-------1-111-111---------------11111111111111111111-11111111111111111111111111111111111111111111111211111111-11111111222211111111--11111111--------------------1---11-1---111111-1-11111111111111111111111111111111111111-1111111111112111-------1-11-221111111--111111111111-111111--1111---111111111111111-111----------1-11111111121-1111111111121111211111111111111111111111111-----------------------------1211111111111111111111111111111111111111111111111111111111111111-111111111111-1111111111111-111111111111111111-1111111---1-------2111133111211112221222222122222111211---1111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---2-----111111111111111-11111111111111111111111111111111111111--------11111111111111111----1-------1111111111---------1---------------------------11--1-111111 --11--1-31--111111-1111-11-11111111111111111111-11111111111111111111-1221112212211111111-11111111-11111311--2-22322211111-11111112B2--2311-1211111--111-111111211---11-1112122-1212E2221112331212133321 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 263 STR:RPRED 98.5 SQ:SECSTR ####HTTcccEEEEEEcHHHHccccccccHHHHHHHHHHHHHHHHcEEEEEEccHHHHHHHHccccTTcccccHHHHHHHHHHHHHHHHHHHHHHHGGGTccEEEEEEcTGGGGcHHHHHHHHHHHHHHHHTTcEEEEEEcTTTccHHHTccEHcTTTHHHHHHHHHHTTccEEEEEEcccccccccTTTcTTcccccEEccccGGGHHTcccccccccccHHHHHHHHHHHHHHTTcEEEEEccccHHHHHHHHcccccccEEEcc DISOP:02AL 1-6,8-8| PSIPRED ccccccccccEEEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEccccccHHHHHHHHHHHHHHHHcccEEEEccccEEEccccccccccccHHHHHHHHHHHHcccEEEEEEcccccccccccccccccEEEEEccccHHHcccccccccccccccHHHHHHHHHHHHHccccEEEEEccccHHHHHHHcccccccEEEEc //