[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : proC
DDBJ      :proC         Pyrroline-5-carboxylate reductase
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  778/915 : Eukaryota  190/199 : Viruses  0/175   --->[See Alignment]
a.100.1c.2.1
:264 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->263 2amfE PDBj 1e-45 40.1 %
:RPS:PDB   1->261 2ahrE PDBj 3e-19 32.1 %
:RPS:SCOP  2->161 2ahrA2  c.2.1.6 * 8e-28 31.8 %
:RPS:SCOP  160->261 1yqgA1  a.100.1.10 * 1e-28 22.5 %
:HMM:SCOP  1->161 2amfA2 c.2.1.6 * 1.1e-34 38.8 %
:HMM:SCOP  160->266 1xc2A1 a.100.1.10 * 1.4e-27 41.1 %
:RPS:PFM   2->85 PF03807 * F420_oxidored 5e-10 41.7 %
:HMM:PFM   2->96 PF03807 * F420_oxidored 4.8e-22 38.7 93/96  
:HMM:PFM   98->146 PF04639 * Baculo_E56 0.0006 30.6 49/306  
:BLT:SWISS 1->263 P5CR_AQUAE 5e-42 38.7 %
:PROS 221->243|PS00521|P5CR
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00071.1 GT:GENE proC GT:PRODUCT Pyrroline-5-carboxylate reductase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1294554..1295348) GB:FROM 1294554 GB:TO 1295348 GB:DIRECTION - GB:GENE proC GB:PRODUCT Pyrroline-5-carboxylate reductase GB:NOTE COG0345 [E] Pyrroline-5-carboxylate reductase GB:PROTEIN_ID ABE00071.1 GB:DB_XREF GI:90821432 GB:GENE:GENE proC LENGTH 264 SQ:AASEQ MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYSQETGVSACESNSEVIEKSDVVFLAVKPIVVEKVLKEVKDSVLTHDPVLVSVVTGVSVAELEDILGSKDVKIVRTMPNVNVEIGEGMTALHKNDNVSDEDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAFVYFFIDSLARSGVKYGLNKQKATQIAAQAVLGSALKVLKSDKTPWELVDDVSSPGGTTVAGLLAMEEAGFMTSIVKGVDATISKDKG GT:EXON 1|1-264:0| BL:SWS:NREP 1 BL:SWS:REP 1->263|P5CR_AQUAE|5e-42|38.7|256/265| PROS 221->243|PS00521|P5CR|PDOC00451| SEG 90->100|vlvsvvtgvsv| BL:PDB:NREP 1 BL:PDB:REP 1->263|2amfE|1e-45|40.1|252/259| RP:PDB:NREP 1 RP:PDB:REP 1->261|2ahrE|3e-19|32.1|246/252| RP:PFM:NREP 1 RP:PFM:REP 2->85|PF03807|5e-10|41.7|84/96|F420_oxidored| HM:PFM:NREP 2 HM:PFM:REP 2->96|PF03807|4.8e-22|38.7|93/96|F420_oxidored| HM:PFM:REP 98->146|PF04639|0.0006|30.6|49/306|Baculo_E56| RP:SCP:NREP 2 RP:SCP:REP 2->161|2ahrA2|8e-28|31.8|151/152|c.2.1.6| RP:SCP:REP 160->261|1yqgA1|1e-28|22.5|102/111|a.100.1.10| HM:SCP:REP 1->161|2amfA2|1.1e-34|38.8|152/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 160->266|1xc2A1|1.4e-27|41.1|107/0|a.100.1.10|1/1|6-phosphogluconate dehydrogenase C-terminal domain-like| OP:NHOMO 1366 OP:NHOMOORG 1004 OP:PATTERN 11-1-11-1111111111-1-------111-11-1-----------1--1111--1-11111111--- 11-1111111111111111-1111111111111111111111111-11111111111111111111111111111211--11111111112111-------112211111--------------111111111111111111111111111111111111111111121211111111111111111121112343434534345455523443345421211112222123211111111111111111111211-11-1---1122111111111111111111111111111111111111111111111111111111111111111111111112221111211--111111111111-111111--1111-11111-11111111111111111111111111----1-1-1111-511232133221--111-1-111111111111111-1111-11----1111----------------------111121221-1111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111-1111-111111111-1-----1-111111111111-111111111112111112111111--11111------11211111111111111-11111111111111111111211111111111111111111111111111111111111111111--1111111111111111111111-1111111122222111111111111111121111111111111111111111111111111111111111111111111111111---------1-----1---------------------11--11111111 11-1222-311-111223242215333111111-11111111-111332333632121211111111111111111111111111111-12121111111111212-13144533321111133432B3GY4-8571313333321322-31133222123312122325A22312112G1112211212112121112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 263 STR:RPRED 99.6 SQ:SECSTR cEEEEEcccHHHHHHHHHTTccccEEEEEEEEcccHHHHHHHHHHHTccccccHHHHHTTccEEEEcccGGGHHHHHTTccccccEEEccTccHcccccGGHHHHHHHcTTccEEEEccGGGGTcEEEEEEEcTTccccHHHHHHHHHHHHTcEEEEEccGGGHHHHHHHTTTHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccTTcHHHHHHHHHHHHTHHHHHHHHHHHHHHHHH# DISOP:02AL 263-265| PSIPRED cEEEEEcccHHHHHHHHHHHHccccHHHEEEEcccHHHHHHHHHHcccEEEccHHHHHccccEEEEEccHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHcccccccEEEEEccccHHHHccEEEEEccccccHHHHHHHHHHHHHcccEEEEcHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcc //