[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rbsB
DDBJ      :rbsB         D-ribose-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  163/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.93.1
:330 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   47->321 2ioyA PDBj 8e-21 26.4 %
:RPS:PDB   46->295 3d02A PDBj 1e-21 16.2 %
:RPS:SCOP  46->295 1gubA  c.93.1.1 * 3e-24 18.7 %
:HMM:SCOP  44->324 2fvyA1 c.93.1.1 * 1.5e-60 31.8 %
:HMM:PFM   46->318 PF00532 * Peripla_BP_1 7.7e-15 22.0 264/279  
:BLT:SWISS 42->290 RBSB_BACSU 4e-15 28.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98906.1 GT:GENE rbsB GT:PRODUCT D-ribose-binding protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(104563..105555) GB:FROM 104563 GB:TO 105555 GB:DIRECTION - GB:GENE rbsB GB:PRODUCT D-ribose-binding protein GB:NOTE COG1653 [G] ABC-type sugar transport system, periplasmic component GB:PROTEIN_ID ABD98906.1 GB:DB_XREF GI:90820267 GB:GENE:GENE rbsB LENGTH 330 SQ:AASEQ MKYKLTKFIKKKDFVRLISIAIFLLGIILVVWISSFYMPFVKQPVKIGSTYMTLNNSFYKTINEEVKKQVSQNGDILYTRDPGLSVSKQCQQIYDFIDKKVDVILINPVNGESKQIQHALKIAHDKGIKIVVVDSQLSNSSFVNANVVSDNFKAGVLDAKYMMKSSPQAKILVLRHWNALSVKERYRGFVSEIKDNPNYQITENLETLGQTDVALKNVQELLKVDPDKFDIIMAMDDQSAVGALAAMDALNLHNKIMVYGIDGSTNMKHLLLSNPNAQATVAQSPIKLGQKSIQVCYKLVKGKKVPKDVVVPVFLLTKKNINDYDVSGWQ GT:EXON 1|1-330:0| BL:SWS:NREP 1 BL:SWS:REP 42->290|RBSB_BACSU|4e-15|28.8|240/305| TM:NTM 1 TM:REGION 16->38| SEG 138->151|snssfvnanvvsdn| SEG 298->313|klvkgkkvpkdvvvpv| BL:PDB:NREP 1 BL:PDB:REP 47->321|2ioyA|8e-21|26.4|269/274| RP:PDB:NREP 1 RP:PDB:REP 46->295|3d02A|1e-21|16.2|241/291| HM:PFM:NREP 1 HM:PFM:REP 46->318|PF00532|7.7e-15|22.0|264/279|Peripla_BP_1| RP:SCP:NREP 1 RP:SCP:REP 46->295|1gubA|3e-24|18.7|246/288|c.93.1.1| HM:SCP:REP 44->324|2fvyA1|1.5e-60|31.8|277/0|c.93.1.1|1/1|Periplasmic binding protein-like I| OP:NHOMO 177 OP:NHOMOORG 163 OP:PATTERN -------------------------------------------------------------------- -------------------------1---------------------------2------------111--------------------------------------1-1--------------------------------------------------------11-----------------------1-1-----------------1111-----1---1-------1------------------11-1--11----1-----1-1----11111111-1111------------------------1--------2---2----------1-1-----1---1------------1--1111-1--------------2-111------------------2----------1-----11------1-----------------------------------------------------------------------1111111----11-------11--------------------1--------------------------------------------------------------------------------------------3--------------1-----------------1111-111112122211-111111212112111111111111---11111111111111111---------111111111111---------------1-1------------------------------------------------------11111111111111-------------------------------------------------------------111-----1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 321 STR:RPRED 97.3 SQ:SECSTR HHHTTccEEEEEHHHHHHHHTcTTcEEEETcccHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHHHTTEEEEEccccccHHHHHHHHHHHHHTTccEEEEccccccHHHHHHHHHHHHHTTcEEEEEccTTccTTccEEEEcccHHHHHHHHHHHHHHTTcEEEEEEccccccHHHHHHHHHHHHHHHHHTcTTEEccccccTTcHHHHHHHHHHHHHcTTcEEEEEEccTTHHHHHHHHHHHTTcTTTcEEEEcHHHHccHHHHHHHTcccEEEEccHHHHHHHHHHHHHHHHTTcccccEEEEccEEEETTTc######### DISOP:02AL 1-1,330-331| PSIPRED cccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHcccEEEEEcccccccccEEccccccHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHccccccEEEEEEcccHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHHHccccccccEEEEEEEEcHHHHHHccccccc //