[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rluB
DDBJ      :rluB         Ribosomal large subunit pseudouridine synthase B
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  867/915 : Eukaryota  33/199 : Viruses  0/175   --->[See Alignment]
d.265.1d.66.1
:242 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->241 3dh3C PDBj 3e-32 32.8 %
:RPS:PDB   3->239 3dh3B PDBj 9e-37 28.8 %
:RPS:SCOP  4->56 1vioA2  d.66.1.5 * 6e-12 28.3 %
:RPS:SCOP  63->236 1kskA4  d.265.1.3 * 1e-36 31.8 %
:HMM:SCOP  4->103 1c06A_ d.66.1.2 * 1.2e-24 39.4 %
:HMM:SCOP  60->236 1vioA1 d.265.1.3 * 1.2e-44 38.4 %
:RPS:PFM   4->47 PF01479 * S4 1e-04 45.5 %
:RPS:PFM   69->193 PF00849 * PseudoU_synth_2 3e-17 43.5 %
:HMM:PFM   64->197 PF00849 * PseudoU_synth_2 2.1e-28 26.9 134/164  
:HMM:PFM   3->49 PF01479 * S4 1.4e-16 44.7 47/48  
:HMM:PFM   184->218 PF02043 * Bac_chlorC 0.00081 22.9 35/82  
:BLT:SWISS 3->241 RLUB_BACSU 8e-64 50.0 %
:PROS 1->54|PS00430|TONB_DEPENDENT_REC_1
:PROS 101->115|PS01149|PSI_RSU
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99748.1 GT:GENE rluB GT:PRODUCT Ribosomal large subunit pseudouridine synthase B GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(967428..968156) GB:FROM 967428 GB:TO 968156 GB:DIRECTION - GB:GENE rluB GB:PRODUCT Ribosomal large subunit pseudouridine synthase B GB:NOTE COG1187 [J] 16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases GB:PROTEIN_ID ABD99748.1 GB:DB_XREF GI:90821109 GB:GENE:GENE rluB LENGTH 242 SQ:AASEQ MAERLQKVMANAGVASRRASEKLIQEGRVMVNGVVVTELGTKVESDDSISVDGKLLKKDEKKVYYLLYKPRGVISAAKDNKGREVVTDYLKDVPERLYPVGRLDYDTSGLLILTNDGDFANQMMHPRYKVDKTYVAKVEGLITPDSIKKLRNGVVIDGKPTSRARAKILSRDAKKNTSIVSLTIHEGRYHQVKKMFDAVGHKVQKLSRTTYGTLTLDGLTSGEYRELSHNEVRELLKLINNK GT:EXON 1|1-242:0| BL:SWS:NREP 1 BL:SWS:REP 3->241|RLUB_BACSU|8e-64|50.0|238/244| PROS 1->54|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| PROS 101->115|PS01149|PSI_RSU|PDOC00885| SEG 209->222|ttygtltldgltsg| BL:PDB:NREP 1 BL:PDB:REP 4->241|3dh3C|3e-32|32.8|229/239| RP:PDB:NREP 1 RP:PDB:REP 3->239|3dh3B|9e-37|28.8|229/241| RP:PFM:NREP 2 RP:PFM:REP 4->47|PF01479|1e-04|45.5|44/46|S4| RP:PFM:REP 69->193|PF00849|3e-17|43.5|124/149|PseudoU_synth_2| HM:PFM:NREP 3 HM:PFM:REP 64->197|PF00849|2.1e-28|26.9|134/164|PseudoU_synth_2| HM:PFM:REP 3->49|PF01479|1.4e-16|44.7|47/48|S4| HM:PFM:REP 184->218|PF02043|0.00081|22.9|35/82|Bac_chlorC| GO:PFM:NREP 5 GO:PFM GO:0003723|"GO:RNA binding"|PF01479|IPR002942| GO:PFM GO:0001522|"GO:pseudouridine synthesis"|PF00849|IPR006145| GO:PFM GO:0003723|"GO:RNA binding"|PF00849|IPR006145| GO:PFM GO:0009451|"GO:RNA modification"|PF00849|IPR006145| GO:PFM GO:0009982|"GO:pseudouridine synthase activity"|PF00849|IPR006145| RP:SCP:NREP 2 RP:SCP:REP 4->56|1vioA2|6e-12|28.3|53/58|d.66.1.5| RP:SCP:REP 63->236|1kskA4|1e-36|31.8|170/172|d.265.1.3| HM:SCP:REP 4->103|1c06A_|1.2e-24|39.4|99/159|d.66.1.2|1/1|Alpha-L RNA-binding motif| HM:SCP:REP 60->236|1vioA1|1.2e-44|38.4|172/0|d.265.1.3|1/1|Pseudouridine synthase| OP:NHOMO 2052 OP:NHOMOORG 900 OP:PATTERN -------------------------------------------------------------------- 1221111111111111111-11111111111111111111111111111111111111--11111111111-1111111111121322111111-11--21333143412-1111111-11111111111111111111111111122122222222222122222222221211111211111112222-222-4444444344444422222244422232332222223332222222222222222222-21222212222211222222213333333333322333333333333333333333333333333333323324222222242422223344232222221111121111222222-22211333311111121111111111111111111111-3322222212112111222222221144121111112221111111111111322------------1111111111111-----1212-2222242232434444444344444444434343333333344432332553454453334333322243421113111111111111111121111113111211111111111111111112112233442355624545666677755556-77577--2111211111143333444444444444-4444444444444444444444333344444444444444444544434442-433343333444--2211111222224234333333333333323333333344333333333333-33333331111111113544644444445445555555555122211122211111111111121311111-21111--11111--12---2212221112133 21--22--511-------------------------------------------------------------------------------------------------62-----------------------------------------------------3---------1-1-15A333111111-114342222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 241 STR:RPRED 99.6 SQ:SECSTR HHEEHHHHHHTTTcccHHHHHHHHHTTcEEETTEEccTTcEEccccEEETTEEEccccGGGccEEEEEEcTTcccccccccTTcHHHHHTcccccccEEccccccccEEEEEEEccTHHHHHHHcGGGcccEEEEEEEcccccHHHHHHHHTccccccccccccEEEEcccEEEEcccEEEEEEccccTTHHHHHHHHTTccEEEEEEEEETTEEcTTccTTcEEEccHHHHHHHHHTccc# DISOP:02AL 1-1,242-243| PSIPRED cHHHHHHHHHHcccccHHHHHHHHHcccEEEccEEccccccccccccEEEEEEcccccccccEEEEEEcccccEEccccccccHHHHHHHHcccccEEEcccccccccEEEEEEccHHHHHHHHHHHccccEEEEEEEEccccHHHHHHHHcccEEcccccccEEEEEEEEcccccEEEEEEEEcccccHHHHHHHHHcccEEEEEEEEccEEEEEcccccccEEEccHHHHHHHHHHHccc //