[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rluD.2
DDBJ      :rluD         Ribosomal large subunit pseudouridine synthase D
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  903/915 : Eukaryota  174/199 : Viruses  0/175   --->[See Alignment]
d.265.1d.66.1
:295 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   80->295 1xpiA PDBj 8e-25 34.0 %
:RPS:PDB   10->94 1dm9A PDBj 8e-04 16.7 %
:RPS:PDB   77->294 2apoA PDBj 5e-24 15.5 %
:RPS:SCOP  10->94 1dm9A  d.66.1.3 * 3e-04 16.7 %
:RPS:SCOP  80->295 1v9kA  d.265.1.3 * 5e-48 32.2 %
:HMM:SCOP  69->295 1przA_ d.265.1.3 * 5.3e-57 31.8 %
:RPS:PFM   88->237 PF00849 * PseudoU_synth_2 2e-17 40.1 %
:HMM:PFM   86->239 PF00849 * PseudoU_synth_2 7.4e-27 27.5 153/164  
:HMM:PFM   34->71 PF01243 * Pyridox_oxidase 0.0005 34.2 38/89  
:BLT:SWISS 15->295 YJBO_BACSU 1e-52 38.3 %
:PROS 130->144|PS01129|PSI_RLU
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00110.1 GT:GENE rluD.2 GT:PRODUCT Ribosomal large subunit pseudouridine synthase D GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1350377..1351264) GB:FROM 1350377 GB:TO 1351264 GB:DIRECTION - GB:GENE rluD GB:PRODUCT Ribosomal large subunit pseudouridine synthase D GB:NOTE COG0564 [J] Pseudouridylate synthases, 23S RNA-specific GB:PROTEIN_ID ABE00110.1 GB:DB_XREF GI:90821471 GB:GENE:GENE rluD LENGTH 295 SQ:AASEQ MQINWIYSEDVSCKLKTFLKKQGISRRLLAKVRYSDGKILINGKSGRKIDKIKKNDKITLVVPDEEFRRSVPPSFVPIKILYEDDNYLLVDKPAFVASIPSPLHPNDSLVNRVVGYYQIRGYRGIIPHIVTRLDRDTSGIVIFAKHRYAHALLDSQLKEHKISKTYTAILSGILHNNHYIIDLPIGRDSTSLIKRKVLFSEKAKRSKTEIFVEERIRDNTLCKIKLHTGRTHQIRVHCSYLGYPLVSDTLYGGTISMPLQRQALHCSEVVFWDQFSSQYIKVKSNISQDMMNYLK GT:EXON 1|1-295:0| BL:SWS:NREP 1 BL:SWS:REP 15->295|YJBO_BACSU|1e-52|38.3|277/283| PROS 130->144|PS01129|PSI_RLU|PDOC00869| SEG 48->58|kidkikkndki| BL:PDB:NREP 1 BL:PDB:REP 80->295|1xpiA|8e-25|34.0|209/229| RP:PDB:NREP 2 RP:PDB:REP 10->94|1dm9A|8e-04|16.7|84/104| RP:PDB:REP 77->294|2apoA|5e-24|15.5|187/304| RP:PFM:NREP 1 RP:PFM:REP 88->237|PF00849|2e-17|40.1|142/149|PseudoU_synth_2| HM:PFM:NREP 2 HM:PFM:REP 86->239|PF00849|7.4e-27|27.5|153/164|PseudoU_synth_2| HM:PFM:REP 34->71|PF01243|0.0005|34.2|38/89|Pyridox_oxidase| GO:PFM:NREP 4 GO:PFM GO:0001522|"GO:pseudouridine synthesis"|PF00849|IPR006145| GO:PFM GO:0003723|"GO:RNA binding"|PF00849|IPR006145| GO:PFM GO:0009451|"GO:RNA modification"|PF00849|IPR006145| GO:PFM GO:0009982|"GO:pseudouridine synthase activity"|PF00849|IPR006145| RP:SCP:NREP 2 RP:SCP:REP 10->94|1dm9A|3e-04|16.7|84/104|d.66.1.3| RP:SCP:REP 80->295|1v9kA|5e-48|32.2|211/227|d.265.1.3| HM:SCP:REP 69->295|1przA_|5.3e-57|31.8|223/252|d.265.1.3|1/1|Pseudouridine synthase| OP:NHOMO 2783 OP:NHOMOORG 1082 OP:PATTERN --------------------------------------11111------------------------- 2121122233321222223-42111222222122222323111111221111212111111112211221121111112111111222434413-111121223133324-2222222-211114111111111111222211121223233311222112213112222113111113111133311221433-3333333333333322333333333333223333334533333333333333333333-34344343334444444443333333333333333333333333333333333333333333333333332333333333333343333333334332332122141121212223133213233322222323223333333322222222223-322333332221233222222222333322333333322333333332222234222222222221122222222222222122233333222222223222222222222222222222222232223332444443244332223333444442222438142415122222123333334346566932433333333332333333333333332254443353664599999A876798-9798A2-3222322222234443453334333343-33343334343333333334444444533333333333333335334334331444444444444222422222222233523545444443544334555455422346444444444-33444442222222225766355555555543333333333222222444432222223222221211112-22122222222122222222212222222232 -111-11---112221111-111111-11111--1-111111111111-1111111-1111121222211322222322312222211-12111111-1112121--2424221222-11112122111352-212-1112222111-12221222122--1232214222-11121117545-2211413455322-3 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 287 STR:RPRED 97.3 SQ:SECSTR ########HcccEEHHHHHHTTTcccHHHHHHHHHTTcEEETTEEccTTccccccTEcEEcccccEEETTEETTEEccHHHHHHTEEEEEEEcccccHcccccHHHHHHHHHHTTcccEccEEcccEEEcccccTTcEEEEEEEEGGGGGGHHHcGGGTTcccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHTcHcEEEEcccEEEEEEEEEEEEETTEEEEEEEEcTTccHHHHHHHHHHHTTccEEEEEEETTEEEEEEETTEEGGGcccHHHHHHHHHHHHTccccHHHH PSIPRED cEEEEEEccccccHHHHHHHHcccccHHHHHHHHHcccEEEccEEEEEEcccccccEEEEEEccccccccccccccccEEEEEcccEEEEEccccEEEEcccccccccHHHHHHHHHHHccccccEEEEEEcccccccEEEEEEccHHHHHHHHHHHHHccccEEEEEEEccEEccccEEEEcccccccccccEEEEEEcccccccccEEEEEEEcccEEEEEEEEcccccHHHHHHHHHccccEEccccccccccccccccEEEEEEEEEEccccccEEEEEccccHHHHHHHc //