[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rluD.4
DDBJ      :rluD         Ribosomal large subunit pseudouridine synthase D
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  902/915 : Eukaryota  160/199 : Viruses  0/175   --->[See Alignment]
d.265.1d.66.1
:296 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   76->291 1v9fA PDBj 2e-23 35.7 %
:RPS:PDB   10->291 3dh3B PDBj 3e-29 18.3 %
:RPS:SCOP  10->93 1dm9A  d.66.1.3 * 4e-07 14.3 %
:RPS:SCOP  79->296 1v9kA  d.265.1.3 * 7e-52 33.0 %
:HMM:SCOP  68->295 1przA_ d.265.1.3 * 2.8e-60 40.0 %
:RPS:PFM   87->237 PF00849 * PseudoU_synth_2 9e-22 46.2 %
:HMM:PFM   85->236 PF00849 * PseudoU_synth_2 8.5e-30 33.8 151/164  
:BLT:SWISS 13->291 YJBO_BACSU 6e-50 37.3 %
:PROS 129->143|PS01129|PSI_RLU

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00286.1 GT:GENE rluD.4 GT:PRODUCT Ribosomal large subunit pseudouridine synthase D GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1539467..1540357) GB:FROM 1539467 GB:TO 1540357 GB:DIRECTION - GB:GENE rluD GB:PRODUCT Ribosomal large subunit pseudouridine synthase D GB:NOTE COG0564 [J] Pseudouridylate synthases, 23S RNA-specific GB:PROTEIN_ID ABE00286.1 GB:DB_XREF GI:90821647 GB:GENE:GENE rluD LENGTH 296 SQ:AASEQ MKFTWNKESDEKMTLKKFLKNKGVSHRTLSSLKKGNGKVLVDGKKRSLSIEVGKGKITLILPPEKSDENVKMSKEPLDIIYEDSNWLVVDKPPLLSSVPGPSNRTDTLVNRVKFHLWQQKSKDLVPHVITRLDRDTSGLVLVAKHRFAQGLINKQVEEHSIDKKYLAVVEGIITEKHGIIDKPLGPRENGIGQMVTDTGKIAKTEYWVREYLGDKATLVECKLHTGRTHQIRAHFSSINHALVGDELYGGRLDWGLERQALHAYQLAYVDPFTQEEKLFKSEMPKDLENLIVRLKN GT:EXON 1|1-296:0| BL:SWS:NREP 1 BL:SWS:REP 13->291|YJBO_BACSU|6e-50|37.3|276/283| PROS 129->143|PS01129|PSI_RLU|PDOC00869| BL:PDB:NREP 1 BL:PDB:REP 76->291|1v9fA|2e-23|35.7|213/250| RP:PDB:NREP 1 RP:PDB:REP 10->291|3dh3B|3e-29|18.3|240/241| RP:PFM:NREP 1 RP:PFM:REP 87->237|PF00849|9e-22|46.2|143/149|PseudoU_synth_2| HM:PFM:NREP 1 HM:PFM:REP 85->236|PF00849|8.5e-30|33.8|151/164|PseudoU_synth_2| GO:PFM:NREP 4 GO:PFM GO:0001522|"GO:pseudouridine synthesis"|PF00849|IPR006145| GO:PFM GO:0003723|"GO:RNA binding"|PF00849|IPR006145| GO:PFM GO:0009451|"GO:RNA modification"|PF00849|IPR006145| GO:PFM GO:0009982|"GO:pseudouridine synthase activity"|PF00849|IPR006145| RP:SCP:NREP 2 RP:SCP:REP 10->93|1dm9A|4e-07|14.3|84/104|d.66.1.3| RP:SCP:REP 79->296|1v9kA|7e-52|33.0|212/227|d.265.1.3| HM:SCP:REP 68->295|1przA_|2.8e-60|40.0|225/252|d.265.1.3|1/1|Pseudouridine synthase| OP:NHOMO 2830 OP:NHOMOORG 1067 OP:PATTERN --------------------------------------11111------------------------- 2121122233321211111-11111211111112123211111111222111111111111112111211111111112111111222334314-211122223234424-2222222-211114111111111112222211131223233311222222223112222112111112111133311221433-3333333333333322333333333333223333334533333333333333333333-34344343334444444443333333334444333333333333334444444443443333444333332333333333333343333333334332332122141121212223132214333322222333222333333222222222223-323333331232233222222222334433333333333222222223223334222222222331122222222222222-222333332222222232222222222222222222222222222243223324322333322244233333322225471424261123221233333432465569624333233333333333333334333322654544637735888879966688-988892-3233322122244444554444444444-44444444444444444444444444544444444334444445444444431544444444444222422222222233625555455454554444444344534436433433333-33333332222222226777566666667664433333333222222444432332223222231211112-22121221111222221122222222222232 -1----2-2-1122211-1-111111-11111-----------11111-11111--1111-121122111222222321221111111-12111-11-1111121-1131422222--11112122111362-21211112222111-11221222122--12333-4222-1122221A867-2111515245521-4 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 291 STR:RPRED 98.3 SQ:SECSTR #####HHHHcccEEHHHHHHTTTcccHHHHHHHHHTTcEEETTEEccTTcEEcccccEEETTEEETccEEETTEEEccccGGGccEEEEEEcTTcccccccccTTcHHHHHTccccccccGGcGEEEEccccccccEEEEEEEccTHHHHHHHcGGGGGcccEEEEEEEcccccHHHHHHHHTcccccccHHHcccccccccccEEEEccccccTTcEEEEEEccccTTHHHHHHHHTTccEEEEEEEEEEHHHEETTEEcTTccTTcEEEccHHHHHHHHHTccccccccHHHHc PSIPRED cEEEEEccccccccHHHHHHHcccccHHHHHHHHHcccEEEccEEEccccEEccccEEEEcccccccccccccccccEEEEEcccEEEEEcccccEEEccccccccHHHHHHHHHHHHccccccEEEEEEcccccccEEEEEEccHHHHHHHHHHHHHccEEEEEEEEEEEEEccccEEEEccccccccccEEEEccccEEcccEEEEEEEccccEEEEEEEEEccccHHHHHHHHHccccEEcccccccccccccccccEEEEEEEEEccccccEEEEEccccHHHHHHHHHHcc //