[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rnc
DDBJ      :rnc          Ribonuclease III
Swiss-Prot:RNC_LACS1    RecName: Full=Ribonuclease 3;         EC=3.1.26.3;AltName: Full=Ribonuclease III;         Short=RNase III;

Homologs  Archaea  9/68 : Bacteria  877/915 : Eukaryota  131/199 : Viruses  2/175   --->[See Alignment]
a.149.1d.50.1
:232 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->196 1o0wB PDBj 7e-29 34.0 %
:RPS:PDB   2->154 2a11A PDBj 6e-38 32.0 %
:RPS:PDB   162->232 2dixA PDBj 2e-08 14.5 %
:RPS:SCOP  7->154 1o0wA1  a.149.1.1 * 1e-41 35.1 %
:RPS:SCOP  162->232 2dixA1  d.50.1.1 * 1e-08 14.5 %
:HMM:SCOP  2->163 1jfzA_ a.149.1.1 * 1.6e-45 44.6 %
:HMM:SCOP  149->232 1qu6A2 d.50.1.1 * 4e-21 37.8 %
:RPS:PFM   47->137 PF00636 * Ribonuclease_3 9e-17 39.6 %
:HMM:PFM   47->137 PF00636 * Ribonuclease_3 3.8e-24 34.1 91/105  
:HMM:PFM   165->230 PF00035 * dsrm 3.7e-17 43.1 65/67  
:BLT:SWISS 1->232 RNC_LACS1 e-123 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99435.1 GT:GENE rnc GT:PRODUCT Ribonuclease III GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 668797..669495 GB:FROM 668797 GB:TO 669495 GB:DIRECTION + GB:GENE rnc GB:PRODUCT Ribonuclease III GB:NOTE COG0571 [K] dsRNA-specific ribonuclease GB:PROTEIN_ID ABD99435.1 GB:DB_XREF GI:90820796 GB:GENE:GENE rnc LENGTH 232 SQ:AASEQ MIEGLQEMLKRDFNITFKDVDLLDAAFTHASYVNETPERKKKLKYYERIEFLGDAVMQLCVSEYIYEHYPEMPEGKMSRLRAAMVRADSFSKFAIECHFNEYIRLGKGEEKGNARQRPSLLCDIFESFIGALYLDQGKDEVVRFISKVIFPKLELGWFDHMMDNKTELQEVLQQNGECKIKYNEVNVTGPDNERVYTMNVVVNNEVMGEGTGRTKKAAEQMAAYQALKKLRK GT:EXON 1|1-232:0| SW:ID RNC_LACS1 SW:DE RecName: Full=Ribonuclease 3; EC=3.1.26.3;AltName: Full=Ribonuclease III; Short=RNase III; SW:GN Name=rnc; OrderedLocusNames=LSL_0625; SW:KW Complete proteome; Cytoplasm; Endonuclease; Hydrolase; Nuclease;RNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->232|RNC_LACS1|e-123|100.0|232/232| GO:SWS:NREP 5 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0004519|"GO:endonuclease activity"|Endonuclease| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0004518|"GO:nuclease activity"|Nuclease| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| SEG 197->212|tmnvvvnnevmgegtg| BL:PDB:NREP 1 BL:PDB:REP 7->196|1o0wB|7e-29|34.0|188/239| RP:PDB:NREP 2 RP:PDB:REP 2->154|2a11A|6e-38|32.0|147/154| RP:PDB:REP 162->232|2dixA|2e-08|14.5|69/84| RP:PFM:NREP 1 RP:PFM:REP 47->137|PF00636|9e-17|39.6|91/93|Ribonuclease_3| HM:PFM:NREP 2 HM:PFM:REP 47->137|PF00636|3.8e-24|34.1|91/105|Ribonuclease_3| HM:PFM:REP 165->230|PF00035|3.7e-17|43.1|65/67|dsrm| GO:PFM:NREP 3 GO:PFM GO:0003723|"GO:RNA binding"|PF00636|IPR000999| GO:PFM GO:0004525|"GO:ribonuclease III activity"|PF00636|IPR000999| GO:PFM GO:0006396|"GO:RNA processing"|PF00636|IPR000999| RP:SCP:NREP 2 RP:SCP:REP 7->154|1o0wA1|1e-41|35.1|148/169|a.149.1.1| RP:SCP:REP 162->232|2dixA1|1e-08|14.5|69/73|d.50.1.1| HM:SCP:REP 2->163|1jfzA_|1.6e-45|44.6|148/0|a.149.1.1|1/1|RNase III domain-like| HM:SCP:REP 149->232|1qu6A2|4e-21|37.8|82/89|d.50.1.1|1/1|dsRNA-binding domain-like| OP:NHOMO 1165 OP:NHOMOORG 1019 OP:PATTERN --------------------------------1-----111111--21-------------------- 1111111111111111111-1111111111111111-11111111111111111111111111111-111111111111111111111111111111---1111111111111111111111111111111111111111111111-12-22211---1-11-22-12222-1-111-1-11------11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11--1-11111111111111111111111111111111-11111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111--111111111111111-111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111-111111111 -----11-------111----111-1-11----111-122211----1--------2-1111-11111-1-1111211111111-122--1-1111-------112---12212424211112-341616J4142712223123-2211-41162322212322232121523211---------2456-55--11221 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--- STR:NPRED 232 STR:RPRED 100.0 SQ:SECSTR TccccHHHHHHHHTccccHHHHHHHHTccHHHHHHTTcccTTcccTHHHHHHHHHHHHHHHHHHHHHHcTTccHHHHHHHHHHHHcHHHHHHHHHHHccGGGccccHHHHHTTGGGcHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHTHHHHHHHHHccccHHHHHHHcTTTEEEcccEEcEEEEEEcccTTccEEEEEEETTTEEEEEEEccHHHHHHHHHHHHHHHHHH DISOP:02AL 1-6,106-118,208-217| PSIPRED ccHHHHHHHHHHHccccccHHHHHHHHccHHHccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcHHHHHHHHHHccccHHEEccccHHHcccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccEEEEEEEEccccccEEEEEEEEccccccccccccHHHHHHHHHHHHHHHHcc //