[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rplA
DDBJ      :rplA         LSU ribosomal protein L1P
Swiss-Prot:RL1_LACS1    RecName: Full=50S ribosomal protein L1;

Homologs  Archaea  6/68 : Bacteria  909/915 : Eukaryota  97/199 : Viruses  0/175   --->[See Alignment]
e.24.1
:230 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->226 3bboD PDBj 4e-47 44.4 %
:RPS:PDB   15->229 1ad2A PDBj 3e-58 39.1 %
:RPS:SCOP  15->229 1ad2A  e.24.1.1 * 1e-58 39.1 %
:HMM:SCOP  7->229 1ad2A_ e.24.1.1 * 9.1e-77 52.0 %
:RPS:PFM   20->222 PF00687 * Ribosomal_L1 1e-47 51.5 %
:HMM:PFM   17->222 PF00687 * Ribosomal_L1 3.5e-83 56.3 206/209  
:BLT:SWISS 15->230 RL1_LACS1 e-113 100.0 %
:PROS 122->140|PS01199|RIBOSOMAL_L1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00046.1 GT:GENE rplA GT:PRODUCT LSU ribosomal protein L1P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1272059..1272751) GB:FROM 1272059 GB:TO 1272751 GB:DIRECTION - GB:GENE rplA GB:PRODUCT LSU ribosomal protein L1P GB:NOTE COG0081 [J] Ribosomal protein L1 GB:PROTEIN_ID ABE00046.1 GB:DB_XREF GI:90821407 GB:GENE:GENE rplA LENGTH 230 SQ:AASEQ MAKKKSKKYLEAAKQVEEGKLYNASEAFGLVKKIDFANFDATIEVAFNLNVDTKQADQQLRGAMVLPNGTGKDQTVVVFAKGAKAQEAKDAGADVVGDDDLVARIQDGWLDFDVAIATPDMMAQVGRLGRVLGPKGLMPNPKTGTVTMDVTKAVTDAKSGQVTYRTDRDGNVHVPLGKVSFTEEALEGNFKAVYDVIAKARPASVKGVYIKHVSVASTFGPSVTLDTTAL GT:EXON 1|1-230:0| SW:ID RL1_LACS1 SW:DE RecName: Full=50S ribosomal protein L1; SW:GN Name=rplA; OrderedLocusNames=LSL_1239; SW:KW Complete proteome; Repressor; Ribonucleoprotein; Ribosomal protein;RNA-binding; rRNA-binding; Translation regulation; tRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 15->230|RL1_LACS1|e-113|100.0|216/230| GO:SWS:NREP 6 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| GO:SWS GO:0006417|"GO:regulation of translation"|Translation regulation| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| PROS 122->140|PS01199|RIBOSOMAL_L1|PDOC00922| SEG 2->14|akkkskkyleaak| SEG 90->100|dagadvvgddd| BL:PDB:NREP 1 BL:PDB:REP 22->226|3bboD|4e-47|44.4|205/227| RP:PDB:NREP 1 RP:PDB:REP 15->229|1ad2A|3e-58|39.1|215/224| RP:PFM:NREP 1 RP:PFM:REP 20->222|PF00687|1e-47|51.5|200/206|Ribosomal_L1| HM:PFM:NREP 1 HM:PFM:REP 17->222|PF00687|3.5e-83|56.3|206/209|Ribosomal_L1| GO:PFM:NREP 2 GO:PFM GO:0003723|"GO:RNA binding"|PF00687|IPR002143| GO:PFM GO:0006396|"GO:RNA processing"|PF00687|IPR002143| RP:SCP:NREP 1 RP:SCP:REP 15->229|1ad2A|1e-58|39.1|215/224|e.24.1.1| HM:SCP:REP 7->229|1ad2A_|9.1e-77|52.0|223/224|e.24.1.1|1/1|Ribosomal protein L1| OP:NHOMO 1063 OP:NHOMOORG 1012 OP:PATTERN -----------------------1----------111------------1-------------1---- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ------1-1---11111111111111-1111-1111111111-11111111-1-111--11111111----1111-11111--11-11--2-1--1111---1111--3----------------------------------------------------------------112222Q1-2223234-32112111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 216 STR:RPRED 93.9 SQ:SECSTR ##############cccTTccccHHHHHHHHHTTcccccccEEEEEEEEcccTTcGGGccEEEEEccccccTTccEEEEccTHHHHHHHHTTccEEEcGGGHHHHHTTcccccEEEEcGGGHHHHHHHHHHHHHHTccccTTTTcccccHHHHHHHHHTTEEEEEccTTcEEEEEEEETTccHHHHHHHHHHHHHHHHTTccTTcccccEEEEEEEcTTcccEEEcTTcc DISOP:02AL 1-11,229-229| PSIPRED cccHHHHHHHHHHHcccHHHcccHHHHHHHHHHccccccccEEEEEEEEccccccccccEEEEEEcccccccccEEEEEccHHHHHHHHHccccccccHHHHHHHHcccccccEEEEcHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHcccEEEEEccccEEEEEEEcccccHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEEcccccEEEccccc //