[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rplC
DDBJ      :rplC         LSU ribosomal protein L3P
Swiss-Prot:RL3_LACS1    RecName: Full=50S ribosomal protein L3;

Homologs  Archaea  13/68 : Bacteria  907/915 : Eukaryota  174/199 : Viruses  0/175   --->[See Alignment]
b.43.3
:207 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->207 2zjrB PDBj 1e-47 49.7 %
:RPS:PDB   63->207 3bboF PDBj 7e-07 42.1 %
:RPS:SCOP  4->207 1vs6D1  b.43.3.2 * 2e-68 46.1 %
:HMM:SCOP  2->207 1ffkB_ b.43.3.2 * 6.4e-73 52.4 %
:RPS:PFM   10->203 PF00297 * Ribosomal_L3 1e-40 52.8 %
:HMM:PFM   10->203 PF00297 * Ribosomal_L3 8.8e-44 40.7 194/263  
:BLT:SWISS 1->207 RL3_LACS1 e-117 100.0 %
:PROS 103->126|PS00474|RIBOSOMAL_L3

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00239.1 GT:GENE rplC GT:PRODUCT LSU ribosomal protein L3P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1495557..1496180) GB:FROM 1495557 GB:TO 1496180 GB:DIRECTION - GB:GENE rplC GB:PRODUCT LSU ribosomal protein L3P GB:NOTE COG0087 [J] Ribosomal protein L3 GB:PROTEIN_ID ABE00239.1 GB:DB_XREF GI:90821600 GB:GENE:GENE rplC LENGTH 207 SQ:AASEQ MTTKGILGKKVGMTQVFTENGELVPVTVVKVDSNVVLQVKTMENDGYEAIQLGFDDLREVLTNKPAKGHAAKANTTPKRFVREIRDVELGEYKVGDEVKADIFEAGDFVDVTGTSKGHGFQGSIKRNGQHRGPMAHGSRYHRRPGSMGVIINRVMKGKLLPGRMGGNRVTIQNLEIVKADTENGVLLIKGNVPGANKSLVTIKSTVK GT:EXON 1|1-207:0| SW:ID RL3_LACS1 SW:DE RecName: Full=50S ribosomal protein L3; SW:GN Name=rplC; OrderedLocusNames=LSL_1435; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->207|RL3_LACS1|e-117|100.0|207/207| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 103->126|PS00474|RIBOSOMAL_L3|PDOC00385| BL:PDB:NREP 1 BL:PDB:REP 4->207|2zjrB|1e-47|49.7|199/205| RP:PDB:NREP 1 RP:PDB:REP 63->207|3bboF|7e-07|42.1|145/154| RP:PFM:NREP 1 RP:PFM:REP 10->203|PF00297|1e-40|52.8|193/196|Ribosomal_L3| HM:PFM:NREP 1 HM:PFM:REP 10->203|PF00297|8.8e-44|40.7|194/263|Ribosomal_L3| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00297|IPR000597| GO:PFM GO:0005622|"GO:intracellular"|PF00297|IPR000597| GO:PFM GO:0005840|"GO:ribosome"|PF00297|IPR000597| GO:PFM GO:0006412|"GO:translation"|PF00297|IPR000597| RP:SCP:NREP 1 RP:SCP:REP 4->207|1vs6D1|2e-68|46.1|204/209|b.43.3.2| HM:SCP:REP 2->207|1ffkB_|6.4e-73|52.4|206/337|b.43.3.2|1/1|Translation proteins| OP:NHOMO 1164 OP:NHOMOORG 1094 OP:PATTERN -----1----------1-1-111----------1----11111----------------------1-- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111-1111111111111111111111111111112111111211111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 22--111-2---1111111111111111111111111111111111111111111111111-111111-1111111111111111111-12111111111111111-1212221121--1111-11-1-241-112--1-1-111111111--2-1111-111111-111111222122S2222232431221131111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 204 STR:RPRED 98.6 SQ:SECSTR ###cEEEEEEEEEEEEEEETTEEEEEEEEEcccEEEEEEEcTTTTcccEEEEEcccccGGGccHHHHTTcccccccccccccccccccccTTTTcccccccccccccccccccccccccccccccccccccccccccccTTTcccccccccTTTTTTccccccccccccccccccEEEEETTTTEEEEccccccccccccccccccc DISOP:02AL 1-1,130-143,207-208| PSIPRED cEEEEEEEEEEcEEEEEcccccEEEEEEEEEccEEEEEEEcccccccEEEEEEHHHcccccccHHHHHHHHHcccccccEEEEEEEccccccccccEEEHHHcccccEEEEEEEEcccccEEEEEEcccccccccccccccccccccccccccccccccccccccccEEEEEccEEEEEcccccEEEEEEccccccccEEEEEEccc //