[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rplD
DDBJ      :rplD         LSU ribosomal protein L1E
Swiss-Prot:RL4_LACS1    RecName: Full=50S ribosomal protein L4;

Homologs  Archaea  0/68 : Bacteria  906/915 : Eukaryota  143/199 : Viruses  0/175   --->[See Alignment]
c.22.1
:207 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->207 1vs6E PDBj 3e-38 44.1 %
:RPS:PDB   1->207 3bboG PDBj 1e-61 32.9 %
:RPS:SCOP  8->207 1vs6E1  c.22.1.1 * 1e-42 41.7 %
:HMM:SCOP  2->206 1dmgA_ c.22.1.1 * 1e-77 49.8 %
:RPS:PFM   17->205 PF00573 * Ribosomal_L4 1e-40 49.7 %
:HMM:PFM   17->204 PF00573 * Ribosomal_L4 6.8e-73 47.9 188/192  
:BLT:SWISS 1->207 RL4_LACS1 e-105 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00238.1 GT:GENE rplD GT:PRODUCT LSU ribosomal protein L1E GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1494909..1495532) GB:FROM 1494909 GB:TO 1495532 GB:DIRECTION - GB:GENE rplD GB:PRODUCT LSU ribosomal protein L1E GB:NOTE COG0088 [J] Ribosomal protein L4 GB:PROTEIN_ID ABE00238.1 GB:DB_XREF GI:90821599 GB:GENE:GENE rplD LENGTH 207 SQ:AASEQ MPTVALFKQDGNQNGEVQLNEAIFGIEPNNNVVFDAVIMQRASLRQGTHAVKNRSAVRGGGKKPWRQKGTGRARQGSIRSPQWVGGGTVFGPTPRSYSYKLPRKVRRLAIKSVLSQKVADESLVVVDALNFDAPKTKAFAEVLSNLNVNSKVLVVLEDDNTTAALAARNLKNVTVIPAKGLNVLDVINNDKLVITQGALSQVEEVLA GT:EXON 1|1-207:0| SW:ID RL4_LACS1 SW:DE RecName: Full=50S ribosomal protein L4; SW:GN Name=rplD; OrderedLocusNames=LSL_1434; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->207|RL4_LACS1|e-105|100.0|207/207| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| SEG 142->156|vlsnlnvnskvlvvl| BL:PDB:NREP 1 BL:PDB:REP 19->207|1vs6E|3e-38|44.1|188/201| RP:PDB:NREP 1 RP:PDB:REP 1->207|3bboG|1e-61|32.9|207/211| RP:PFM:NREP 1 RP:PFM:REP 17->205|PF00573|1e-40|49.7|189/190|Ribosomal_L4| HM:PFM:NREP 1 HM:PFM:REP 17->204|PF00573|6.8e-73|47.9|188/192|Ribosomal_L4| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00573|IPR002136| GO:PFM GO:0005622|"GO:intracellular"|PF00573|IPR002136| GO:PFM GO:0005840|"GO:ribosome"|PF00573|IPR002136| GO:PFM GO:0006412|"GO:translation"|PF00573|IPR002136| RP:SCP:NREP 1 RP:SCP:REP 8->207|1vs6E1|1e-42|41.7|199/201|c.22.1.1| HM:SCP:REP 2->206|1dmgA_|1e-77|49.8|205/225|c.22.1.1|1/1|Ribosomal protein L4| OP:NHOMO 1119 OP:NHOMOORG 1049 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111-1111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111-11 ----111-----1-111111111111111-1111111111-1111111111111-1111111------------------------11-1211111---1-11112-11123111111-1-11121111363-111-11111111--1--1--11--11111121-1111911212222H2222143531321121112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 207 STR:RPRED 100.0 SQ:SECSTR cEEEEccccccccccEEEEccccccccccTTTTTTHHHHHHHHHccccccccccTTcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHTTccccccGGGTTccccHHHHTHHHccccccccccEEccccccccTTTccccccEEcccccccHHHHHHcccEEccTTHHHHHHHHcc DISOP:02AL 45-75| PSIPRED ccccEEEcccccEEEEEEccHHHHccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHcccccEEEEEEEcccccHHHHcccccccEEEEcccccHHHEEcccEEEEEHHHHHHHHHHHc //