[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rplE
DDBJ      :rplE         LSU ribosomal protein L5P
Swiss-Prot:RL5_LACS1    RecName: Full=50S ribosomal protein L5;

Homologs  Archaea  65/68 : Bacteria  912/915 : Eukaryota  124/199 : Viruses  0/175   --->[See Alignment]
d.77.1
:180 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->180 1iq4A PDBj 6e-84 82.1 %
:RPS:PDB   1->180 3d5bG PDBj 3e-74 55.6 %
:RPS:SCOP  2->180 1iq4A  d.77.1.1 * 3e-72 82.1 %
:HMM:SCOP  1->180 1mjiA_ d.77.1.1 * 2.3e-76 60.0 %
:RPS:PFM   25->81 PF00281 * Ribosomal_L5 2e-13 62.5 %
:RPS:PFM   86->178 PF00673 * Ribosomal_L5_C 2e-33 63.4 %
:HMM:PFM   86->178 PF00673 * Ribosomal_L5_C 8.3e-43 64.5 93/95  
:HMM:PFM   25->81 PF00281 * Ribosomal_L5 1.6e-26 60.7 56/56  
:BLT:SWISS 1->180 RL5_LACS1 3e-99 100.0 %
:PROS 58->74|PS00358|RIBOSOMAL_L5

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00227.1 GT:GENE rplE GT:PRODUCT LSU ribosomal protein L5P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1490153..1490695) GB:FROM 1490153 GB:TO 1490695 GB:DIRECTION - GB:GENE rplE GB:PRODUCT LSU ribosomal protein L5P GB:NOTE COG0094 [J] Ribosomal protein L5 GB:PROTEIN_ID ABE00227.1 GB:DB_XREF GI:90821588 GB:GENE:GENE rplE LENGTH 180 SQ:AASEQ MVNRLKEKYDNEIVPSLMEKFNYTSIMQAPKVDKIVINMGVGDAVSNAKRLDEAVDELTLIAGQKPVITKAKKSIAGFRLREGMAIGAKVTLRGQRMYEFLDKLVSVSLPRVRDFHGVSKRAFDGRGNYTLGIREQLIFPEIDFDDVNKVRGMDIVIVTTANTDEESRELLTQLGMPFAK GT:EXON 1|1-180:0| SW:ID RL5_LACS1 SW:DE RecName: Full=50S ribosomal protein L5; SW:GN Name=rplE; OrderedLocusNames=LSL_1423; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding; tRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->180|RL5_LACS1|3e-99|100.0|180/180| GO:SWS:NREP 5 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| PROS 58->74|PS00358|RIBOSOMAL_L5|PDOC00309| BL:PDB:NREP 1 BL:PDB:REP 2->180|1iq4A|6e-84|82.1|179/179| RP:PDB:NREP 1 RP:PDB:REP 1->180|3d5bG|3e-74|55.6|180/181| RP:PFM:NREP 2 RP:PFM:REP 25->81|PF00281|2e-13|62.5|56/56|Ribosomal_L5| RP:PFM:REP 86->178|PF00673|2e-33|63.4|93/95|Ribosomal_L5_C| HM:PFM:NREP 2 HM:PFM:REP 86->178|PF00673|8.3e-43|64.5|93/95|Ribosomal_L5_C| HM:PFM:REP 25->81|PF00281|1.6e-26|60.7|56/56|Ribosomal_L5| GO:PFM:NREP 8 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00281|IPR002132| GO:PFM GO:0005622|"GO:intracellular"|PF00281|IPR002132| GO:PFM GO:0005840|"GO:ribosome"|PF00281|IPR002132| GO:PFM GO:0006412|"GO:translation"|PF00281|IPR002132| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00673|IPR002132| GO:PFM GO:0005622|"GO:intracellular"|PF00673|IPR002132| GO:PFM GO:0005840|"GO:ribosome"|PF00673|IPR002132| GO:PFM GO:0006412|"GO:translation"|PF00673|IPR002132| RP:SCP:NREP 1 RP:SCP:REP 2->180|1iq4A|3e-72|82.1|179/179|d.77.1.1| HM:SCP:REP 1->180|1mjiA_|2.3e-76|60.0|180/180|d.77.1.1|1/1|Ribosomal protein L5| OP:NHOMO 1231 OP:NHOMOORG 1101 OP:PATTERN 11111111111111111-11111111111111-1-111111111111111111111111111111111 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111112111111111111111111-11111111111111111111111111111111 111111111--1111222222222221221-112222222222--12222222222222222221222-1222213332322212233-12222122221111457--21--------------1--------------------------------------1------1221-1------1-185962631111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 180 STR:RPRED 100.0 SQ:SECSTR cccHHHHHHHTTHHHHHHHTTccccTTTcccEEEEEEEEcccTTTTcHHHHHHHHHHHHHHHTccccccccccccTTTTccccccccEEEEEcHHHHHHHHHHHHHTTTTTcTTcccccTTccccccEEccEEccGGGccccccTTccccccEEEEEEEccccHHHHHHHHHHHTccccc DISOP:02AL 1-2,180-181| PSIPRED ccHHHHHHHHHHHHHHHHHHHccccHHHcccEEEEEEEcccccccccHHHHHHHHHHHHHHHccccEEEEccccccccccccccEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEEEEEccccccccccccccEEEEEEEccccHHHHHHHHHHHcccccc //