[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rplF
DDBJ      :rplF         LSU ribosomal protein L6P
Swiss-Prot:RL6_LACS1    RecName: Full=50S ribosomal protein L6;

Homologs  Archaea  37/68 : Bacteria  908/915 : Eukaryota  104/199 : Viruses  0/175   --->[See Alignment]
d.141.1
:178 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->170 1rl6A PDBj 4e-41 65.3 %
:RPS:PDB   1->178 3bboI PDBj 8e-51 44.9 %
:RPS:SCOP  9->82 1rl6A1  d.141.1.1 * 2e-22 55.4 %
:RPS:SCOP  83->170 1rl6A2  d.141.1.1 * 2e-29 60.2 %
:HMM:SCOP  5->82 1ffk11 d.141.1.1 * 7.6e-21 48.7 %
:HMM:SCOP  83->171 1rl6A2 d.141.1.1 * 5.4e-30 62.9 %
:RPS:PFM   11->82 PF00347 * Ribosomal_L6 6e-05 43.1 %
:HMM:PFM   11->82 PF00347 * Ribosomal_L6 1.1e-23 50.0 72/77  
:HMM:PFM   91->164 PF00347 * Ribosomal_L6 8.6e-22 38.0 71/77  
:BLT:SWISS 1->178 RL6_LACS1 5e-92 100.0 %
:PROS 154->162|PS00525|RIBOSOMAL_L6_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00224.1 GT:GENE rplF GT:PRODUCT LSU ribosomal protein L6P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1488953..1489489) GB:FROM 1488953 GB:TO 1489489 GB:DIRECTION - GB:GENE rplF GB:PRODUCT LSU ribosomal protein L6P GB:NOTE COG0097 [J] Ribosomal protein L6P/L9E GB:PROTEIN_ID ABE00224.1 GB:DB_XREF GI:90821585 GB:GENE:GENE rplF LENGTH 178 SQ:AASEQ MSRIGYKVVNLPEGVEVKQDGNVVTVKGPKGELTREFSDKITIKVEGNEVSFERSAEDNKTKALHGTTRSNFHNMVVGVSEGFKKELELRGVGYRAQMKGKTLVLNVGYSHPVEFEEEEGITFETPSATSIIVSGINKEEVGDCAARIRATRAPEPYKGKGIRYVGEYVRRKEGKTGK GT:EXON 1|1-178:0| SW:ID RL6_LACS1 SW:DE RecName: Full=50S ribosomal protein L6; SW:GN Name=rplF; OrderedLocusNames=LSL_1420; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->178|RL6_LACS1|5e-92|100.0|178/178| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 154->162|PS00525|RIBOSOMAL_L6_1|PDOC00454| SEG 114->125|efeeeegitfet| BL:PDB:NREP 1 BL:PDB:REP 27->170|1rl6A|4e-41|65.3|144/164| RP:PDB:NREP 1 RP:PDB:REP 1->178|3bboI|8e-51|44.9|178/182| RP:PFM:NREP 1 RP:PFM:REP 11->82|PF00347|6e-05|43.1|72/74|Ribosomal_L6| HM:PFM:NREP 2 HM:PFM:REP 11->82|PF00347|1.1e-23|50.0|72/77|Ribosomal_L6| HM:PFM:REP 91->164|PF00347|8.6e-22|38.0|71/77|Ribosomal_L6| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00347|IPR020040| GO:PFM GO:0005840|"GO:ribosome"|PF00347|IPR020040| GO:PFM GO:0006412|"GO:translation"|PF00347|IPR020040| GO:PFM GO:0019843|"GO:rRNA binding"|PF00347|IPR020040| RP:SCP:NREP 2 RP:SCP:REP 9->82|1rl6A1|2e-22|55.4|74/75|d.141.1.1| RP:SCP:REP 83->170|1rl6A2|2e-29|60.2|88/89|d.141.1.1| HM:SCP:REP 5->82|1ffk11|7.6e-21|48.7|78/79|d.141.1.1|1/1|Ribosomal protein L6| HM:SCP:REP 83->171|1rl6A2|5.4e-30|62.9|89/89|d.141.1.1|1/1|Ribosomal protein L6| OP:NHOMO 1087 OP:NHOMOORG 1049 OP:PATTERN 111-11--111111-11----------------1-11111-111111111111111---11---1--- 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 ------------11111111111111-111111111-111111111-1111111-1111---111111-11-1111111111111111-12111111111111111--2------------------------------------------------------1----------11111H111122465122------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 178 STR:RPRED 100.0 SQ:SECSTR ccccccccccccTTccEEEcccEEEEccccccEEEEcccccEEEcccccEEEEcccccTTHHHHHHHHTTTTTHHHHHTTTcEEEcEEcccTTccEEEcccEEEEcccccccEEEEccccEEEEcccTTccEEEEcccHHHHHHHHHTTccccccTTTccccEETTcccccccccccc DISOP:02AL 1-1,176-179| PSIPRED ccccccEEEEcccccEEEEEccEEEEEEcccEEEEEccccEEEEEEccEEEEEEccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEccEEEEEEccEEEEEEccccccEEcccccEEEEcccccEEEEEEccHHHHHHHHHHHcccccccccccccEEEccEEEEEccccccc //