[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rplK
DDBJ      :rplK         LSU ribosomal protein L11P
Swiss-Prot:RL11_LACS1   RecName: Full=50S ribosomal protein L11;

Homologs  Archaea  59/68 : Bacteria  910/915 : Eukaryota  166/199 : Viruses  0/175   --->[See Alignment]
a.4.7d.47.1
:141 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->141 2k3fA PDBj 1e-53 69.5 %
:RPS:PDB   2->140 3bboK PDBj 3e-47 58.3 %
:RPS:SCOP  9->69 1mmsA2  d.47.1.1 * 2e-22 77.0 %
:RPS:SCOP  68->140 1hc8A  a.4.7.1 * 1e-26 79.5 %
:HMM:SCOP  1->84 1wibA_ d.47.1.1 * 2.2e-31 52.4 %
:HMM:SCOP  67->140 1hc8A_ a.4.7.1 * 3.2e-28 64.9 %
:RPS:PFM   9->66 PF03946 * Ribosomal_L11_N 1e-17 69.0 %
:RPS:PFM   71->139 PF00298 * Ribosomal_L11 9e-17 68.1 %
:HMM:PFM   8->66 PF03946 * Ribosomal_L11_N 3.1e-33 64.4 59/60  
:HMM:PFM   71->139 PF00298 * Ribosomal_L11 4.3e-33 65.2 69/69  
:BLT:SWISS 1->141 RL11_LACS1 4e-76 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00047.1 GT:GENE rplK GT:PRODUCT LSU ribosomal protein L11P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1272854..1273279) GB:FROM 1272854 GB:TO 1273279 GB:DIRECTION - GB:GENE rplK GB:PRODUCT LSU ribosomal protein L11P GB:NOTE COG0080 [J] Ribosomal protein L11 GB:PROTEIN_ID ABE00047.1 GB:DB_XREF GI:90821408 GB:GENE:GENE rplK LENGTH 141 SQ:AASEQ MAKNVVNVVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDRSFDFVTKTPPAAVLLKKAAGVEKGSGEPNMKKVATVTKDQVKEIAETKMQDLNAADVEAAMRMIEGTARSMGFVVED GT:EXON 1|1-141:0| SW:ID RL11_LACS1 SW:DE RecName: Full=50S ribosomal protein L11; SW:GN Name=rplK; OrderedLocusNames=LSL_1240; SW:KW Complete proteome; Methylation; Ribonucleoprotein; Ribosomal protein;RNA-binding; rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->141|RL11_LACS1|4e-76|100.0|141/141| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| BL:PDB:NREP 1 BL:PDB:REP 1->141|2k3fA|1e-53|69.5|141/141| RP:PDB:NREP 1 RP:PDB:REP 2->140|3bboK|3e-47|58.3|139/145| RP:PFM:NREP 2 RP:PFM:REP 9->66|PF03946|1e-17|69.0|58/60|Ribosomal_L11_N| RP:PFM:REP 71->139|PF00298|9e-17|68.1|69/69|Ribosomal_L11| HM:PFM:NREP 2 HM:PFM:REP 8->66|PF03946|3.1e-33|64.4|59/60|Ribosomal_L11_N| HM:PFM:REP 71->139|PF00298|4.3e-33|65.2|69/69|Ribosomal_L11| GO:PFM:NREP 6 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF03946|IPR000911| GO:PFM GO:0005840|"GO:ribosome"|PF03946|IPR000911| GO:PFM GO:0006412|"GO:translation"|PF03946|IPR000911| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00298|IPR000911| GO:PFM GO:0005840|"GO:ribosome"|PF00298|IPR000911| GO:PFM GO:0006412|"GO:translation"|PF00298|IPR000911| RP:SCP:NREP 2 RP:SCP:REP 9->69|1mmsA2|2e-22|77.0|61/63|d.47.1.1| RP:SCP:REP 68->140|1hc8A|1e-26|79.5|73/74|a.4.7.1| HM:SCP:REP 1->84|1wibA_|2.2e-31|52.4|82/0|d.47.1.1|1/1|Ribosomal L11/L12e N-terminal domain| HM:SCP:REP 67->140|1hc8A_|3.2e-28|64.9|74/0|a.4.7.1|1/1|Ribosomal protein L11, C-terminal domain| OP:NHOMO 1205 OP:NHOMOORG 1135 OP:PATTERN --111111111111111------1111111111111111111111111111111111111111-1111 1111111111111111111-11111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111311111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 11------31--111111111111111111111111-1-11111111111111111111111111111111111111-1111111111-11111111111111112--3-1111-1-1-1--1-12-2-453-212111-111111-11-11111--1111-1111-111-11112222N222124224-321131112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 100.0 SQ:SECSTR cccccccEEEEcccTTcccccTTTTTTTTTTcccTTccHHHHHHHGGGcccccccEEEEEcccccEEEEEccccTTHHHHHHHTcccccccTTTcccEEEcHHHHHHHHHHTcTTcccccHHHHHHHHHHHHTTTTEEEcc DISOP:02AL 1-1,83-96| PSIPRED cccEEEEEEEEEEEccccccccccHHHHHcccccHHHHHHHHHHHHHHccccEEEEEEEEEcccEEEEEEEcccHHHHHHHHccccccccccccEEEEEEcHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccEEEcc //