[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rplL
DDBJ      :rplL         LSU ribosomal protein L12P
Swiss-Prot:RL7_LACS1    RecName: Full=50S ribosomal protein L7/L12;

Homologs  Archaea  0/68 : Bacteria  425/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.108.1d.45.1
:122 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->101 1rquA PDBj 5e-09 48.5 %
:RPS:PDB   3->122 1dd3A PDBj 3e-12 33.3 %
:RPS:SCOP  3->31 1dd3A1  a.108.1.1 * 7e-05 31.0 %
:RPS:SCOP  56->122 1ctfA  d.45.1.1 * 9e-08 41.8 %
:HMM:SCOP  3->58 1dd3A1 a.108.1.1 * 8.3e-14 57.1 %
:HMM:SCOP  55->122 1ctfA_ d.45.1.1 * 3.4e-24 66.2 %
:RPS:PFM   55->122 PF00542 * Ribosomal_L12 4e-05 45.6 %
:HMM:PFM   56->122 PF00542 * Ribosomal_L12 7.5e-31 67.2 67/68  
:BLT:SWISS 1->122 RL7_LACS1 1e-35 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00044.1 GT:GENE rplL GT:PRODUCT LSU ribosomal protein L12P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1270871..1271239) GB:FROM 1270871 GB:TO 1271239 GB:DIRECTION - GB:GENE rplL GB:PRODUCT LSU ribosomal protein L12P GB:NOTE COG0222 [J] Ribosomal protein L7/L12 GB:PROTEIN_ID ABE00044.1 GB:DB_XREF GI:90821405 GB:GENE:GENE rplL LENGTH 122 SQ:AASEQ MALDTEKIIADLKEASILELNDLVKAIEEEFGVSAAASVAVAGAAGADGAAEKDSFDVELTDAGSAKVKVIKAVKDITGLGLKDAKGLVDGAPSVIKEGVAKDEAEELKAKLEEVGAKVTLK GT:EXON 1|1-122:0| SW:ID RL7_LACS1 SW:DE RecName: Full=50S ribosomal protein L7/L12; SW:GN Name=rplL; OrderedLocusNames=LSL_1237; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->122|RL7_LACS1|1e-35|100.0|122/122| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| SEG 32->51|gvsaaasvavagaagadgaa| SEG 66->75|akvkvikavk| SEG 104->114|eaeelkaklee| BL:PDB:NREP 1 BL:PDB:REP 2->101|1rquA|5e-09|48.5|99/120| RP:PDB:NREP 1 RP:PDB:REP 3->122|1dd3A|3e-12|33.3|120/128| RP:PFM:NREP 1 RP:PFM:REP 55->122|PF00542|4e-05|45.6|68/68|Ribosomal_L12| HM:PFM:NREP 1 HM:PFM:REP 56->122|PF00542|7.5e-31|67.2|67/68|Ribosomal_L12| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00542|IPR013823| GO:PFM GO:0005622|"GO:intracellular"|PF00542|IPR013823| GO:PFM GO:0005840|"GO:ribosome"|PF00542|IPR013823| GO:PFM GO:0006412|"GO:translation"|PF00542|IPR013823| RP:SCP:NREP 2 RP:SCP:REP 3->31|1dd3A1|7e-05|31.0|29/57|a.108.1.1| RP:SCP:REP 56->122|1ctfA|9e-08|41.8|67/68|d.45.1.1| HM:SCP:REP 3->58|1dd3A1|8.3e-14|57.1|56/57|a.108.1.1|1/1|Ribosomal protein L7/12, oligomerisation (N-terminal) domain| HM:SCP:REP 55->122|1ctfA_|3.4e-24|66.2|68/68|d.45.1.1|1/1|ClpS-like| OP:NHOMO 425 OP:NHOMOORG 425 OP:PATTERN -------------------------------------------------------------------- -11---------1------------------------------------------------------------------11--11-111111-1------1-----11-----------------11-11-111-----------1-------------------------------------1-111---11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111-1111111111-1111111111111111111111111111111111-1---11-1111---1-1-1111-1111-----1-11-----------1--11111111111--------1111-----11------1-------------------------1-11------------------------------1----1-----11111111111111-111111-11---11111111111111111111-11-1111111111-111111--1---1------111----------1---------------1--1---1--1--1111-1-1-1-1-------------1--1---1-11--111-1111111-11------------------------------111111--111111111111111--------11--11-111-1111-1-------111111-1-1111-11----1111111111-1111111111-1-111111-------------1111-----111--1-11111111-----11-------11111111--------------1------1---111------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 121 STR:RPRED 99.2 SQ:SECSTR #cccHHHHHHHHTTccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHTTccEEEEEEEcTTcHHHHHHHHHHHHcccHHHHHHHHTTTTcEEEEEEcHHHHHHHHHHHHHTTcEEEEc DISOP:02AL 1-1| PSIPRED ccccHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHccccccccccccEEEEEEEccccHHHHHHHHHHHcccccHHHHHHHHHHccHHHHccccHHHHHHHHHHHHHccEEEEEc //