[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rplN
DDBJ      :rplN         LSU ribosomal protein L14P
Swiss-Prot:RL14_LACS1   RecName: Full=50S ribosomal protein L14;

Homologs  Archaea  62/68 : Bacteria  906/915 : Eukaryota  152/199 : Viruses  0/175   --->[See Alignment]
b.39.1
:122 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->122 1whiA PDBj 3e-41 78.7 %
:RPS:PDB   1->122 3bboM PDBj 1e-40 52.1 %
:RPS:SCOP  1->122 1s72K  b.39.1.1 * 1e-37 37.3 %
:HMM:SCOP  1->122 2j01O1 b.39.1.1 * 4.2e-50 59.8 %
:RPS:PFM   1->122 PF00238 * Ribosomal_L14 2e-30 59.8 %
:HMM:PFM   1->122 PF00238 * Ribosomal_L14 7.1e-53 64.8 122/122  
:BLT:SWISS 1->122 RL14_LACS1 4e-55 100.0 %
:PROS 60->86|PS00049|RIBOSOMAL_L14
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00229.1 GT:GENE rplN GT:PRODUCT LSU ribosomal protein L14P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1491060..1491428) GB:FROM 1491060 GB:TO 1491428 GB:DIRECTION - GB:GENE rplN GB:PRODUCT LSU ribosomal protein L14P GB:NOTE COG0093 [J] Ribosomal protein L14 GB:PROTEIN_ID ABE00229.1 GB:DB_XREF GI:90821590 GB:GENE:GENE rplN LENGTH 122 SQ:AASEQ MIQQESRLKVADNSGAREILVIKILGGSRVKTANIGDIIVATVKQATPGGVVKKGDVVKAVVVRTKYGTHRPDGSYIKFDENAAVIIGEDKSPKGTRIFGPVARELRDGNFMKIVSLAPEVL GT:EXON 1|1-122:0| SW:ID RL14_LACS1 SW:DE RecName: Full=50S ribosomal protein L14; SW:GN Name=rplN; OrderedLocusNames=LSL_1425; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->122|RL14_LACS1|4e-55|100.0|122/122| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 60->86|PS00049|RIBOSOMAL_L14|PDOC00048| SEG 49->63|ggvvkkgdvvkavvv| BL:PDB:NREP 1 BL:PDB:REP 1->122|1whiA|3e-41|78.7|122/122| RP:PDB:NREP 1 RP:PDB:REP 1->122|3bboM|1e-40|52.1|121/121| RP:PFM:NREP 1 RP:PFM:REP 1->122|PF00238|2e-30|59.8|122/122|Ribosomal_L14| HM:PFM:NREP 1 HM:PFM:REP 1->122|PF00238|7.1e-53|64.8|122/122|Ribosomal_L14| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00238|IPR000218| GO:PFM GO:0005622|"GO:intracellular"|PF00238|IPR000218| GO:PFM GO:0005840|"GO:ribosome"|PF00238|IPR000218| GO:PFM GO:0006412|"GO:translation"|PF00238|IPR000218| RP:SCP:NREP 1 RP:SCP:REP 1->122|1s72K|1e-37|37.3|118/132|b.39.1.1| HM:SCP:REP 1->122|2j01O1|4.2e-50|59.8|122/0|b.39.1.1|1/1|Ribosomal protein L14| OP:NHOMO 1228 OP:NHOMOORG 1120 OP:PATTERN 11111111111111111-1111111111111111111111111111111111111111--11111--- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111-1111111111111111111111111111111111111111111111111111111111111111-11-111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 2111--1-422-2221-11-222122122111122211-11112221-1111111111----21222112232222222222222233-242-222212-1123351-112111-11---1-1111-1-221-213--1-1--1--1-----111111-14-11111113111-2214-----211673132--1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 122 STR:RPRED 100.0 SQ:SECSTR ccccccEEEEcccccEEEEEEEEEccccccccccTTcEEEEEEEEEccccccccccEEEEEEEEccccEEcTTccEEcccccEEEEccTTcccccccccccccGGGTTTTcHHHHHHccccc PSIPRED ccccccEEEEEEccccEEEEEEEEEccccccccccccEEEEEEEEcccccEEEcccEEEEEEEEEEcccccccccEEEEcccEEEEEcccccEEEEEEEcHHHHHHHHcccEEEEEcccccc //