[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rplO
DDBJ      :rplO         LSU ribosomal protein L15P
Swiss-Prot:RL15_LACS1   RecName: Full=50S ribosomal protein L15;

Homologs  Archaea  0/68 : Bacteria  665/915 : Eukaryota  68/199 : Viruses  0/175   --->[See Alignment]
c.12.1
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->113 1vs9J PDBj 4e-15 47.2 %
:RPS:PDB   1->144 3bboN PDBj 4e-18 31.2 %
:RPS:SCOP  1->142 1vs6L1  c.12.1.1 * 1e-30 37.6 %
:HMM:SCOP  4->142 2gyaJ1 c.12.1.1 * 1.9e-48 59.4 %
:RPS:PFM   44->121 PF00828 * Ribosomal_L18e 6e-11 60.5 %
:HMM:PFM   27->143 PF00828 * Ribosomal_L18e 1.2e-33 45.6 114/129  
:BLT:SWISS 1->144 RL15_LACS1 3e-59 100.0 %
:PROS 108->138|PS00475|RIBOSOMAL_L15
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00220.1 GT:GENE rplO GT:PRODUCT LSU ribosomal protein L15P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1487364..1487798) GB:FROM 1487364 GB:TO 1487798 GB:DIRECTION - GB:GENE rplO GB:PRODUCT LSU ribosomal protein L15P GB:NOTE COG0200 [J] Ribosomal protein L15 GB:PROTEIN_ID ABE00220.1 GB:DB_XREF GI:90821581 GB:GENE:GENE rplO LENGTH 144 SQ:AASEQ MKLHELKPAEGSRQVRNRVGRGTSSGNGKTAGRGQKGQKARGKVRLGFEGGQMPLFRRMPKRGFKNINRKEYAIVNLETLNKFEDGAEVTPALLVESGIIKDEKDGIKVLGNGTLNKQLTVKASKFSASAKEAIESKGGKAEVI GT:EXON 1|1-144:0| SW:ID RL15_LACS1 SW:DE RecName: Full=50S ribosomal protein L15; SW:GN Name=rplO; OrderedLocusNames=LSL_1416; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->144|RL15_LACS1|3e-59|100.0|144/144| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 108->138|PS00475|RIBOSOMAL_L15|PDOC00386| SEG 31->43|agrgqkgqkargk| SEG 122->137|kaskfsasakeaiesk| BL:PDB:NREP 1 BL:PDB:REP 1->113|1vs9J|4e-15|47.2|106/147| RP:PDB:NREP 1 RP:PDB:REP 1->144|3bboN|4e-18|31.2|144/176| RP:PFM:NREP 1 RP:PFM:REP 44->121|PF00828|6e-11|60.5|76/129|Ribosomal_L18e| HM:PFM:NREP 1 HM:PFM:REP 27->143|PF00828|1.2e-33|45.6|114/129|Ribosomal_L18e| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00828|IPR000039| GO:PFM GO:0005622|"GO:intracellular"|PF00828|IPR000039| GO:PFM GO:0005840|"GO:ribosome"|PF00828|IPR000039| GO:PFM GO:0006412|"GO:translation"|PF00828|IPR000039| RP:SCP:NREP 1 RP:SCP:REP 1->142|1vs6L1|1e-30|37.6|141/144|c.12.1.1| HM:SCP:REP 4->142|2gyaJ1|1.9e-48|59.4|138/0|c.12.1.1|1/1|Ribosomal proteins L15p and L18e| OP:NHOMO 741 OP:NHOMOORG 733 OP:PATTERN -------------------------------------------------------------------- 111-111-11111111111-111111111111111111111111111111111111111-1111111111111111111111111111111111111--111-11111-11111111-------1---------1-11111111111111111-1--1111111111111111111111-1111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111-1111111111-1111111111111111111111111111111111111111111111111111-------------1--111111111111111111111111111111111111111111111111111111111--11111-11111-1-111111111111111-1-11111111111111111111111------------111111111111111----11----111111---1111-1--1-11-1111111-111--------------------------------------------------------------------------------------111111----1--1---------------------------1-----------------111111111----1------------------------11111112111111111111111111-1111111111111-111111111111111111 ------1------------111-1111---------------------111111111-1----111111111111111-1111111----11-1-1111---1111-12-------------------------------------------------1--------------1-111----1115--1--11-1--12 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 144 STR:RPRED 100.0 SQ:SECSTR ccccccccccccccccccccccccccccccccccccGGGTcccccTTcccccccTTcccccccccccccccccccccccccccTTTTTTcccccccccccccccccccccccccccccccccccccTGGGTTccTTTTccEEcc DISOP:02AL 8-44,130-135| PSIPRED cccccccccccccccccccccccccccccccccccccHHcccccccccccccccHHHHccccccccccccEEEEEEHHHHHHccccccccHHHHHHcccccccccEEEEEEcccccccEEEEEcccccHHHHHHHHcccEEEEc //