[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rplQ
DDBJ      :rplQ         LSU ribosomal protein L17P
Swiss-Prot:RL17_LACS1   RecName: Full=50S ribosomal protein L17;

Homologs  Archaea  0/68 : Bacteria  897/915 : Eukaryota  153/199 : Viruses  0/175   --->[See Alignment]
d.188.1
:127 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->127 1vsaL PDBj 2e-24 50.9 %
:RPS:PDB   3->126 3bboP PDBj 4e-42 47.3 %
:RPS:SCOP  10->127 1gd8A  d.188.1.1 * 1e-37 45.2 %
:HMM:SCOP  10->127 1gd8A_ d.188.1.1 * 7.9e-39 59.6 %
:RPS:PFM   16->126 PF01196 * Ribosomal_L17 1e-23 62.9 %
:HMM:PFM   16->126 PF01196 * Ribosomal_L17 6.1e-41 59.8 97/97  
:BLT:SWISS 1->127 RL17_LACS1 7e-67 100.0 %
:PROS 30->52|PS01167|RIBOSOMAL_L17

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00212.1 GT:GENE rplQ GT:PRODUCT LSU ribosomal protein L17P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1482471..1482854) GB:FROM 1482471 GB:TO 1482854 GB:DIRECTION - GB:GENE rplQ GB:PRODUCT LSU ribosomal protein L17P GB:NOTE COG0203 [J] Ribosomal protein L17 GB:PROTEIN_ID ABE00212.1 GB:DB_XREF GI:90821573 GB:GENE:GENE rplQ LENGTH 127 SQ:AASEQ MAYRKLGRTSAHRKAMLRNLTTDLIVNEKIVTTETRAKEVRKFVEKMITLGKKGDLASRRRAAAFVMNVVADVKEENDDVVVQSALQKLFDDLAPRFAERNGGYTRILKMSERRGDAAKMVVLELVD GT:EXON 1|1-127:0| SW:ID RL17_LACS1 SW:DE RecName: Full=50S ribosomal protein L17; SW:GN Name=rplQ; OrderedLocusNames=LSL_1408; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->127|RL17_LACS1|7e-67|100.0|127/127| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 30->52|PS01167|RIBOSOMAL_L17|PDOC00897| BL:PDB:NREP 1 BL:PDB:REP 4->127|1vsaL|2e-24|50.9|110/118| RP:PDB:NREP 1 RP:PDB:REP 3->126|3bboP|4e-42|47.3|110/116| RP:PFM:NREP 1 RP:PFM:REP 16->126|PF01196|1e-23|62.9|97/97|Ribosomal_L17| HM:PFM:NREP 1 HM:PFM:REP 16->126|PF01196|6.1e-41|59.8|97/97|Ribosomal_L17| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01196|IPR000456| GO:PFM GO:0005622|"GO:intracellular"|PF01196|IPR000456| GO:PFM GO:0005840|"GO:ribosome"|PF01196|IPR000456| GO:PFM GO:0006412|"GO:translation"|PF01196|IPR000456| RP:SCP:NREP 1 RP:SCP:REP 10->127|1gd8A|1e-37|45.2|104/105|d.188.1.1| HM:SCP:REP 10->127|1gd8A_|7.9e-39|59.6|104/105|d.188.1.1|1/1|Prokaryotic ribosomal protein L17| OP:NHOMO 1106 OP:NHOMOORG 1050 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111---11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111112111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111----11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111-11--1111 11--111-1----11111-111111111111-1111111111111111111111-1111111---111--11-11111111111-111--111111---11-1112-141-11111-2-1-11-11111151-111-11-1111111-1-11-111111111-----------112222I2112243441322221112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 126 STR:RPRED 99.2 SQ:SECSTR #ccccTTccGGGHHHHHHHHHHHHHHTccEEEcHHHHHHHHHHHHHHHHHHHHcTTHHHHHHHTTcccccTTHHccccHHHHTTHHHHHTTccGGGGcccccccEEccccccccccccccEEEEEcc DISOP:02AL 1-1,3-11| PSIPRED cccccccccHHHHHHHHHHHHHHHHHccEEEEcHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccEEEEEccccccccccEEEEEEcc //