[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rplR
DDBJ      :rplR         LSU ribosomal protein L18P
Swiss-Prot:RL18_LACS1   RecName: Full=50S ribosomal protein L18;

Homologs  Archaea  0/68 : Bacteria  891/915 : Eukaryota  22/199 : Viruses  0/175   --->[See Alignment]
c.55.4
:118 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->118 1ovyA PDBj 1e-32 68.4 %
:RPS:PDB   4->118 3bboQ PDBj 3e-35 53.9 %
:RPS:SCOP  6->118 1vs6O1  c.55.4.1 * 3e-35 49.1 %
:HMM:SCOP  24->118 1ovyA_ c.55.4.1 * 3.5e-38 64.2 %
:RPS:PFM   11->118 PF00861 * Ribosomal_L18p 2e-23 62.0 %
:HMM:PFM   7->118 PF00861 * Ribosomal_L18p 1.2e-41 51.8 112/119  
:BLT:SWISS 1->118 RL18_LACS1 2e-63 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00223.1 GT:GENE rplR GT:PRODUCT LSU ribosomal protein L18P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1488552..1488908) GB:FROM 1488552 GB:TO 1488908 GB:DIRECTION - GB:GENE rplR GB:PRODUCT LSU ribosomal protein L18P GB:NOTE COG0256 [J] Ribosomal protein L18 GB:PROTEIN_ID ABE00223.1 GB:DB_XREF GI:90821584 GB:GENE:GENE rplR LENGTH 118 SQ:AASEQ MISKPDKNKTRQKRHARVRGKISGTAECPRLNVYRSNKNIYAQVIDDVAGVTLVSASTLDSEVSGNTKTEQASSVGAVVAKRAVEKGIKEVVFDRGGYLYHGRVQALAEAARENGLDF GT:EXON 1|1-118:0| SW:ID RL18_LACS1 SW:DE RecName: Full=50S ribosomal protein L18; SW:GN Name=rplR; OrderedLocusNames=LSL_1419; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->118|RL18_LACS1|2e-63|100.0|118/118| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| BL:PDB:NREP 1 BL:PDB:REP 24->118|1ovyA|1e-32|68.4|95/97| RP:PDB:NREP 1 RP:PDB:REP 4->118|3bboQ|3e-35|53.9|115/122| RP:PFM:NREP 1 RP:PFM:REP 11->118|PF00861|2e-23|62.0|108/118|Ribosomal_L18p| HM:PFM:NREP 1 HM:PFM:REP 7->118|PF00861|1.2e-41|51.8|112/119|Ribosomal_L18p| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00861|IPR005484| GO:PFM GO:0005622|"GO:intracellular"|PF00861|IPR005484| GO:PFM GO:0005840|"GO:ribosome"|PF00861|IPR005484| GO:PFM GO:0006412|"GO:translation"|PF00861|IPR005484| RP:SCP:NREP 1 RP:SCP:REP 6->118|1vs6O1|3e-35|49.1|112/117|c.55.4.1| HM:SCP:REP 24->118|1ovyA_|3.5e-38|64.2|95/0|c.55.4.1|1/1|Translational machinery components| OP:NHOMO 931 OP:NHOMOORG 913 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-1111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111--111111--11111111111111111111111111111111111111111111111111111111111111111-111111-1-11-111111111111111111111111111111111-111111111111111111-11111111111111111-11111111-11111111111111111111-1111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111112111111111111111111-11111--111111-1111111111111111-1 11------1---------------------------------------------------------------------------------------------------2------------------------------------------------------1-----------1111A111114132-11------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 97.5 SQ:SECSTR ###cccccccGGGTccccccGGGGcccccccEEEEccccEEEEEEccTTccEEEEEEHHHHHHHccccHHHHHHHHHHcccHHHHTccccccccccccccccTTHHHHHHHTTTTccc DISOP:02AL 1-9| PSIPRED ccccccHHHHHHHHHHHHHHHHHccccccEEEEEEccccEEEEEEEccccEEEEEEEcHHHHHcccccHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHccccc //