[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rplS
DDBJ      :rplS         LSU ribosomal protein L19P
Swiss-Prot:RL19_LACS1   RecName: Full=50S ribosomal protein L19;

Homologs  Archaea  0/68 : Bacteria  907/915 : Eukaryota  20/199 : Viruses  0/175   --->[See Alignment]
b.34.5
:118 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->115 1vs6P PDBj 4e-32 56.4 %
:RPS:PDB   6->112 3bboR PDBj 4e-31 33.0 %
:RPS:SCOP  1->116 2j01T1  b.34.5.6 * 1e-39 48.3 %
:HMM:SCOP  4->117 2gyaN1 b.34.5.6 * 2.6e-40 59.6 %
:RPS:PFM   7->115 PF01245 * Ribosomal_L19 1e-32 67.0 %
:HMM:PFM   6->115 PF01245 * Ribosomal_L19 7.5e-51 60.9 110/113  
:BLT:SWISS 1->118 RL19_LACS1 4e-64 100.0 %
:PROS 88->103|PS01015|RIBOSOMAL_L19

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99446.1 GT:GENE rplS GT:PRODUCT LSU ribosomal protein L19P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 680239..680595 GB:FROM 680239 GB:TO 680595 GB:DIRECTION + GB:GENE rplS GB:PRODUCT LSU ribosomal protein L19P GB:NOTE COG0335 [J] Ribosomal protein L19 GB:PROTEIN_ID ABD99446.1 GB:DB_XREF GI:90820807 GB:GENE:GENE rplS LENGTH 118 SQ:AASEQ MSVNPLIAKITESQLRNDIPDFRAGDSVRVHARIVEGSRERIQIFEGVVIKRRGEGISETYTVRKISNGIGVERTFPLHTPRVDKIEVTRHGRVRRAKLYYLRALHGKAARIPERRRG GT:EXON 1|1-118:0| SW:ID RL19_LACS1 SW:DE RecName: Full=50S ribosomal protein L19; SW:GN Name=rplS; OrderedLocusNames=LSL_0636; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->118|RL19_LACS1|4e-64|100.0|118/118| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 88->103|PS01015|RIBOSOMAL_L19|PDOC00778| BL:PDB:NREP 1 BL:PDB:REP 6->115|1vs6P|4e-32|56.4|110/114| RP:PDB:NREP 1 RP:PDB:REP 6->112|3bboR|4e-31|33.0|106/113| RP:PFM:NREP 1 RP:PFM:REP 7->115|PF01245|1e-32|67.0|109/112|Ribosomal_L19| HM:PFM:NREP 1 HM:PFM:REP 6->115|PF01245|7.5e-51|60.9|110/113|Ribosomal_L19| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01245|IPR001857| GO:PFM GO:0005622|"GO:intracellular"|PF01245|IPR001857| GO:PFM GO:0005840|"GO:ribosome"|PF01245|IPR001857| GO:PFM GO:0006412|"GO:translation"|PF01245|IPR001857| RP:SCP:NREP 1 RP:SCP:REP 1->116|2j01T1|1e-39|48.3|116/137|b.34.5.6| HM:SCP:REP 4->117|2gyaN1|2.6e-40|59.6|114/0|b.34.5.6|1/1|Translation proteins SH3-like domain| OP:NHOMO 960 OP:NHOMOORG 927 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111-1111111111111111111111111111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1112E1221-3253-52--11111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 98.3 SQ:SECSTR cTTHHcTTHHHHTTccccccccccccccccccccccccccccccccccccccccccccccccccccccccTTTcccccccccccccccccccccccccccccccccTTcccccccc## DISOP:02AL 1-3,117-119| PSIPRED ccHHHHHHHHHHHHHHHcccccccccEEEEEEEEEccccEEEEEEEEEEEEEcccccccEEEEEEccccccEEEEEEcccccEEEEEEEEEcccHHHHHHHHHcccccHHHHHHHHcc //