[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rplT
DDBJ      :rplT         LSU ribosomal protein L20P
Swiss-Prot:RL20_LACS1   RecName: Full=50S ribosomal protein L20;

Homologs  Archaea  0/68 : Bacteria  909/915 : Eukaryota  57/199 : Viruses  0/175   --->[See Alignment]
a.144.2
:120 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->118 1vs6Q PDBj 1e-31 56.9 %
:RPS:PDB   1->116 3bboS PDBj 1e-36 40.5 %
:RPS:SCOP  3->118 1vs6Q1  a.144.2.1 * 2e-37 62.9 %
:HMM:SCOP  61->120 1gyzA_ a.144.2.1 * 2.9e-24 63.3 %
:RPS:PFM   3->109 PF00453 * Ribosomal_L20 1e-24 62.6 %
:HMM:PFM   3->109 PF00453 * Ribosomal_L20 1.6e-48 61.7 107/108  
:BLT:SWISS 1->120 RL20_LACS1 7e-64 100.0 %
:PROS 54->70|PS00937|RIBOSOMAL_L20

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99306.1 GT:GENE rplT GT:PRODUCT LSU ribosomal protein L20P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 546770..547132 GB:FROM 546770 GB:TO 547132 GB:DIRECTION + GB:GENE rplT GB:PRODUCT LSU ribosomal protein L20P GB:NOTE COG0292 [J] Ribosomal protein L20 GB:PROTEIN_ID ABD99306.1 GB:DB_XREF GI:90820667 GB:GENE:GENE rplT LENGTH 120 SQ:AASEQ MPRVKGGSVTRQRRKKIIKLAKGYRGAKHIQFKVAKQQVMKSYQYAFRDRRKTKSNFRKLWIARINAAARQNDISYSKLMHGLKLANVEVNRKMLADLAITDAAAFTALVDEAKKALAAE GT:EXON 1|1-120:0| SW:ID RL20_LACS1 SW:DE RecName: Full=50S ribosomal protein L20; SW:GN Name=rplT; OrderedLocusNames=LSL_0497; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->120|RL20_LACS1|7e-64|100.0|120/120| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 54->70|PS00937|RIBOSOMAL_L20|PDOC00722| BL:PDB:NREP 1 BL:PDB:REP 3->118|1vs6Q|1e-31|56.9|116/117| RP:PDB:NREP 1 RP:PDB:REP 1->116|3bboS|1e-36|40.5|116/119| RP:PFM:NREP 1 RP:PFM:REP 3->109|PF00453|1e-24|62.6|107/108|Ribosomal_L20| HM:PFM:NREP 1 HM:PFM:REP 3->109|PF00453|1.6e-48|61.7|107/108|Ribosomal_L20| GO:PFM:NREP 5 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00453|IPR005813| GO:PFM GO:0005622|"GO:intracellular"|PF00453|IPR005813| GO:PFM GO:0005840|"GO:ribosome"|PF00453|IPR005813| GO:PFM GO:0006412|"GO:translation"|PF00453|IPR005813| GO:PFM GO:0019843|"GO:rRNA binding"|PF00453|IPR005813| RP:SCP:NREP 1 RP:SCP:REP 3->118|1vs6Q1|2e-37|62.9|116/117|a.144.2.1| HM:SCP:REP 61->120|1gyzA_|2.9e-24|63.3|60/60|a.144.2.1|1/1|Ribosomal protein L20| OP:NHOMO 988 OP:NHOMOORG 966 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 11--2------------------------------------------------------------------------------------------------------111-1111--1----1-11-1-122---1---11-11---------2-1--1---1--1-1111--2211217111111323-141111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 120 STR:RPRED 100.0 SQ:SECSTR ccccccTTHHHHHHHHHHHHcccccccTTccHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHHHTcccccccGGGGTTccTTTTTHHHHHHHHHcccc DISOP:02AL 1-1,119-121| PSIPRED cccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHccHHHHHHHHHHHHHHcccc //