[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rplU
DDBJ      :rplU         LSU ribosomal protein L21P
Swiss-Prot:RL21_LACS1   RecName: Full=50S ribosomal protein L21;

Homologs  Archaea  0/68 : Bacteria  658/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
b.155.1
:102 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->100 2j01V PDBj 1e-20 48.5 %
:RPS:PDB   1->102 3bboT PDBj 1e-29 34.3 %
:RPS:SCOP  1->102 1vs6R1  b.155.1.1 * 2e-26 40.2 %
:HMM:SCOP  1->102 2i2tR1 b.155.1.1 * 1.2e-35 52.9 %
:RPS:PFM   1->95 PF00829 * Ribosomal_L21p 4e-19 60.0 %
:HMM:PFM   1->95 PF00829 * Ribosomal_L21p 4.6e-41 62.1 95/96  
:BLT:SWISS 1->102 RL21_LACS1 5e-47 100.0 %
:PROS 71->93|PS01169|RIBOSOMAL_L21
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99766.1 GT:GENE rplU GT:PRODUCT LSU ribosomal protein L21P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(980910..981218) GB:FROM 980910 GB:TO 981218 GB:DIRECTION - GB:GENE rplU GB:PRODUCT LSU ribosomal protein L21P GB:NOTE COG0261 [J] Ribosomal protein L21 GB:PROTEIN_ID ABD99766.1 GB:DB_XREF GI:90821127 GB:GENE:GENE rplU LENGTH 102 SQ:AASEQ MYAIIKTGGKQLKVEAGQTIYVEKLDAKEGDKVTFDKVVFVGGDKTVIGTPFVEGATVEATVEKQGRAKKVVTFKYKPKKHQHTKQGHRQPYTKVVIDAINA GT:EXON 1|1-102:0| SW:ID RL21_LACS1 SW:DE RecName: Full=50S ribosomal protein L21; SW:GN Name=rplU; OrderedLocusNames=LSL_0956; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->102|RL21_LACS1|5e-47|100.0|102/102| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 71->93|PS01169|RIBOSOMAL_L21|PDOC00899| SEG 69->80|kkvvtfkykpkk| BL:PDB:NREP 1 BL:PDB:REP 1->100|2j01V|1e-20|48.5|99/101| RP:PDB:NREP 1 RP:PDB:REP 1->102|3bboT|1e-29|34.3|102/104| RP:PFM:NREP 1 RP:PFM:REP 1->95|PF00829|4e-19|60.0|95/96|Ribosomal_L21p| HM:PFM:NREP 1 HM:PFM:REP 1->95|PF00829|4.6e-41|62.1|95/96|Ribosomal_L21p| GO:PFM:NREP 5 GO:PFM GO:0003723|"GO:RNA binding"|PF00829|IPR001787| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00829|IPR001787| GO:PFM GO:0005622|"GO:intracellular"|PF00829|IPR001787| GO:PFM GO:0005840|"GO:ribosome"|PF00829|IPR001787| GO:PFM GO:0006412|"GO:translation"|PF00829|IPR001787| RP:SCP:NREP 1 RP:SCP:REP 1->102|1vs6R1|2e-26|40.2|102/103|b.155.1.1| HM:SCP:REP 1->102|2i2tR1|1.2e-35|52.9|102/0|b.155.1.1|1/1|L21p-like| OP:NHOMO 663 OP:NHOMOORG 662 OP:PATTERN -------------------------------------------------------------------- -----1---------------1----------1--------------1----------------111----111111111-1-1----11--1---1--111111--1-1-------111----1--------------111111-1111--1--11---1--1--11111--1-------1-11111-1-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--111111111111111111111111111111111111111111-1111-111-111-111-----------11111111111-11-11-1--1-11111111111111-1-111-1111111111111111---1111-------1--111111111111111----1-----111111111111111111111-11111111111111111111111111111111111111111-11111111111111111111111111111111111-111------------1-------11-11111111111111111111111111111111111-1111111-111--11-11111-111-11-1111111111111111111111111111-11-1111111111-111111111-111111111111-111111111111111111111-11----111-111111111-111111-11-1----1------------111111111111111111111111-1111111------------1-111111111-111111-111-11111111-111111111--1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1------------11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 102 STR:RPRED 100.0 SQ:SECSTR cccccccccccccccTTccccccccTccTTcEEEcTTcccccccccccccccccccccEEEcccccccccccEEEccTTTTccEEEcccccccccccccccc PSIPRED cEEEEEEccEEEEEccccEEEEEEcccccccEEEEEEEEEEEccccEEccccccccEEEEEEEEEccccEEEEEEEccccccEEEccccccEEEEEEEEEEc //