[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rplV
DDBJ      :rplV         LSU ribosomal protein L22P
Swiss-Prot:RL22_LACS1   RecName: Full=50S ribosomal protein L22;

Homologs  Archaea  0/68 : Bacteria  900/915 : Eukaryota  19/199 : Viruses  0/175   --->[See Alignment]
d.55.1
:115 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->115 1vsaQ PDBj 5e-31 59.3 %
:RPS:PDB   8->115 3d5bW PDBj 5e-36 59.3 %
:RPS:SCOP  8->115 1bxeA  d.55.1.1 * 1e-43 59.3 %
:HMM:SCOP  6->115 1bxeA_ d.55.1.1 * 1.8e-38 64.5 %
:RPS:PFM   12->112 PF00237 * Ribosomal_L22 4e-22 54.5 %
:HMM:PFM   10->113 PF00237 * Ribosomal_L22 8.7e-43 58.7 104/105  
:BLT:SWISS 1->115 RL22_LACS1 7e-60 100.0 %
:PROS 88->112|PS00464|RIBOSOMAL_L22

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00234.1 GT:GENE rplV GT:PRODUCT LSU ribosomal protein L22P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1493072..1493419) GB:FROM 1493072 GB:TO 1493419 GB:DIRECTION - GB:GENE rplV GB:PRODUCT LSU ribosomal protein L22P GB:NOTE COG0091 [J] Ribosomal protein L22 GB:PROTEIN_ID ABE00234.1 GB:DB_XREF GI:90821595 GB:GENE:GENE rplV LENGTH 115 SQ:AASEQ MAEQVTSAKATAKTVRIPARKARLVIDLIRGKSVAEAFGILKFTPRSGAYLIEKVLKSAVANAENNFDLDVEDLYVSEAFVNEGPTLKRFRPRAKGSASPINKRTSHITVVVSVK GT:EXON 1|1-115:0| SW:ID RL22_LACS1 SW:DE RecName: Full=50S ribosomal protein L22; SW:GN Name=rplV; OrderedLocusNames=LSL_1430; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->115|RL22_LACS1|7e-60|100.0|115/115| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 88->112|PS00464|RIBOSOMAL_L22|PDOC00387| BL:PDB:NREP 1 BL:PDB:REP 8->115|1vsaQ|5e-31|59.3|108/109| RP:PDB:NREP 1 RP:PDB:REP 8->115|3d5bW|5e-36|59.3|108/112| RP:PFM:NREP 1 RP:PFM:REP 12->112|PF00237|4e-22|54.5|101/105|Ribosomal_L22| HM:PFM:NREP 1 HM:PFM:REP 10->113|PF00237|8.7e-43|58.7|104/105|Ribosomal_L22| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00237|IPR001063| GO:PFM GO:0005622|"GO:intracellular"|PF00237|IPR001063| GO:PFM GO:0005840|"GO:ribosome"|PF00237|IPR001063| GO:PFM GO:0006412|"GO:translation"|PF00237|IPR001063| RP:SCP:NREP 1 RP:SCP:REP 8->115|1bxeA|1e-43|59.3|108/110|d.55.1.1| HM:SCP:REP 6->115|1bxeA_|1.8e-38|64.5|110/110|d.55.1.1|1/1|Ribosomal protein L22| OP:NHOMO 934 OP:NHOMOORG 919 OP:PATTERN -------------------------------------------------------------------- 111-111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111---1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111-11111111111111111111111111-111111111111111111111111111111111111--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1111821-21-311-12--1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 108 STR:RPRED 93.9 SQ:SECSTR #######cEEEEEEEEccHHHHHHHHHHTTTccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccGGGEEEEEEEEEEEEEEEcccEETTTEEcccEEEEEEEEEEEEEc DISOP:02AL 1-5| PSIPRED cccccEEEEEEEccccccHHHHHHHHHHHccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccHHHEEEEEEEEccccccccccccccccccccccccccEEEEEEEc //