[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rplW
DDBJ      :rplW         LSU ribosomal protein L23P
Swiss-Prot:RL23_LACS1   RecName: Full=50S ribosomal protein L23;

Homologs  Archaea  0/68 : Bacteria  176/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.12.1
:94 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->90 2zjrQ PDBj 4e-07 30.6 %
:RPS:PDB   4->47 3bboV PDBj 2e-08 34.1 %
:RPS:SCOP  1->94 1vs6T1  d.12.1.1 * 2e-13 20.4 %
:HMM:SCOP  1->95 1n88A_ d.12.1.1 * 4.4e-27 45.7 %
:RPS:PFM   5->46 PF00276 * Ribosomal_L23 3e-04 52.4 %
:HMM:PFM   5->90 PF00276 * Ribosomal_L23 1.5e-30 48.2 85/92  
:BLT:SWISS 1->94 RL23_LACS1 5e-35 100.0 %
:PROS 76->91|PS00050|RIBOSOMAL_L23
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00237.1 GT:GENE rplW GT:PRODUCT LSU ribosomal protein L23P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1494625..1494909) GB:FROM 1494625 GB:TO 1494909 GB:DIRECTION - GB:GENE rplW GB:PRODUCT LSU ribosomal protein L23P GB:NOTE COG0089 [J] Ribosomal protein L23 GB:PROTEIN_ID ABE00237.1 GB:DB_XREF GI:90821598 GB:GENE:GENE rplW LENGTH 94 SQ:AASEQ MESRDVILRPVITEASMAELDNKRYTFDVDTRATKSQIKDAVEDIFEVKVAKVNVMNVKGKKKRMGRYEGYTKKRRKAIVTLTAESKEIKLFEE GT:EXON 1|1-94:0| SW:ID RL23_LACS1 SW:DE RecName: Full=50S ribosomal protein L23; SW:GN Name=rplW; OrderedLocusNames=LSL_1433; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->94|RL23_LACS1|5e-35|100.0|94/94| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 76->91|PS00050|RIBOSOMAL_L23|PDOC00049| SEG 48->67|vkvakvnvmnvkgkkkrmgr| BL:PDB:NREP 1 BL:PDB:REP 5->90|2zjrQ|4e-07|30.6|85/93| RP:PDB:NREP 1 RP:PDB:REP 4->47|3bboV|2e-08|34.1|44/85| RP:PFM:NREP 1 RP:PFM:REP 5->46|PF00276|3e-04|52.4|42/91|Ribosomal_L23| HM:PFM:NREP 1 HM:PFM:REP 5->90|PF00276|1.5e-30|48.2|85/92|Ribosomal_L23| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00276|IPR013025| GO:PFM GO:0005622|"GO:intracellular"|PF00276|IPR013025| GO:PFM GO:0005840|"GO:ribosome"|PF00276|IPR013025| GO:PFM GO:0006412|"GO:translation"|PF00276|IPR013025| RP:SCP:NREP 1 RP:SCP:REP 1->94|1vs6T1|2e-13|20.4|93/99|d.12.1.1| HM:SCP:REP 1->95|1n88A_|4.4e-27|45.7|92/96|d.12.1.1|1/1|Ribosomal proteins S24e, L23 and L15e| OP:NHOMO 176 OP:NHOMOORG 176 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------1----------------1-----------------------------------------------------11111-----1--1---------------1-----11--11111------------1111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111-111-111111111111111111111111-11111111111-1111111111111-111------111111----1--1-11-1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 87 STR:RPRED 92.6 SQ:SECSTR ##cccccccccccHHHHHHHTccEEccEEcTTccHHHHHHTTTTTccccccEEEEccccccccccccccccccccEEEEEEc#ccccccc#### DISOP:02AL 1-1,64-65,67-68| PSIPRED ccHHHHHHHccccHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHccEEEEEEEEEcccHHHHHccccccccccEEEEEEEcccccccccccc //