[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rplX
DDBJ      :rplX         LSU ribosomal protein L24P
Swiss-Prot:RL24_LACS1   RecName: Full=50S ribosomal protein L24;

Homologs  Archaea  0/68 : Bacteria  886/915 : Eukaryota  68/199 : Viruses  0/175   --->[See Alignment]
b.34.5
:101 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->101 1vs6U PDBj 1e-23 54.1 %
:RPS:PDB   1->101 3bboW PDBj 5e-28 43.6 %
:RPS:SCOP  1->101 1vs6U1  b.34.5.1 * 2e-23 53.0 %
:HMM:SCOP  2->100 2gyaS1 b.34.5.1 * 3.7e-35 68.4 %
:HMM:PFM   5->36 PF00467 * KOW 8.2e-11 43.8 32/32  
:HMM:PFM   56->67 PF11784 * DUF3320 0.00019 66.7 12/52  
:BLT:SWISS 1->101 RL24_LACS1 3e-54 100.0 %
:PROS 6->23|PS01108|RIBOSOMAL_L24

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00228.1 GT:GENE rplX GT:PRODUCT LSU ribosomal protein L24P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1490720..1491025) GB:FROM 1490720 GB:TO 1491025 GB:DIRECTION - GB:GENE rplX GB:PRODUCT LSU ribosomal protein L24P GB:NOTE COG0198 [J] Ribosomal protein L24 GB:PROTEIN_ID ABE00228.1 GB:DB_XREF GI:90821589 GB:GENE:GENE rplX LENGTH 101 SQ:AASEQ MFIKKNDKVKVIAGKDKGKEGTVEKVFPAQDRVIVKGINIVKKHQKPTNANPNGGIVEVEAPIHVSNVMLIDPSNNEATRVGFKVVDGKKVRVSKKSGEIL GT:EXON 1|1-101:0| SW:ID RL24_LACS1 SW:DE RecName: Full=50S ribosomal protein L24; SW:GN Name=rplX; OrderedLocusNames=LSL_1424; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->101|RL24_LACS1|3e-54|100.0|101/101| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 6->23|PS01108|RIBOSOMAL_L24|PDOC00852| BL:PDB:NREP 1 BL:PDB:REP 3->101|1vs6U|1e-23|54.1|98/102| RP:PDB:NREP 1 RP:PDB:REP 1->101|3bboW|5e-28|43.6|101/110| HM:PFM:NREP 2 HM:PFM:REP 5->36|PF00467|8.2e-11|43.8|32/32|KOW| HM:PFM:REP 56->67|PF11784|0.00019|66.7|12/52|DUF3320| RP:SCP:NREP 1 RP:SCP:REP 1->101|1vs6U1|2e-23|53.0|100/102|b.34.5.1| HM:SCP:REP 2->100|2gyaS1|3.7e-35|68.4|98/0|b.34.5.1|1/1|Translation proteins SH3-like domain| OP:NHOMO 1006 OP:NHOMOORG 954 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111---1111111111--111111111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111121111111111111111111111111111-11111111111111111111111111111111111111111111111111111111--11111--1111-11111111111111-11111111111111111111111111111111111111111111-111111111111111111--11111111111-11111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111-11-111111-1111111111111111111111111 21--11--2---111----------------------------------------------------------------------------------------1-2---1211111-11--111---1-342-1111----1-11-1---------111---11-111111--111222P122113332-3211-111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 101 STR:RPRED 100.0 SQ:SECSTR ccccccccEEEcccccTTccccccccccccccccccccccccccccccccccccccccccccccGGGEEEccccccccccccccccccccccccccccccc DISOP:02AL 46-56| PSIPRED cccccccEEEEEEccccccEEEEEEEEccccEEEEEcccEEEEEEccccccccccEEEEEccccHHHEEEEEcccccccEEEEEEEccEEEEEEEEccccc //