[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rpmA
DDBJ      :rpmA         LSU ribosomal protein L27P
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  903/915 : Eukaryota  114/199 : Viruses  0/175   --->[See Alignment]
b.84.4
:93 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->92 2wdi0 PDBj 9e-26 65.5 %
:RPS:PDB   9->92 3bboX PDBj 1e-26 54.8 %
:RPS:SCOP  9->90 1vs6W1  b.84.4.1 * 6e-26 58.5 %
:HMM:SCOP  27->92 1v8qA_ b.84.4.1 * 4.8e-22 57.6 %
:RPS:PFM   9->88 PF01016 * Ribosomal_L27 7e-23 70.0 %
:HMM:PFM   9->89 PF01016 * Ribosomal_L27 3.6e-38 60.5 81/81  
:BLT:SWISS 1->92 RL27_ENTFA 2e-44 88.0 %
:PROS 41->55|PS00831|RIBOSOMAL_L27

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99764.1 GT:GENE rpmA GT:PRODUCT LSU ribosomal protein L27P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(980256..980537) GB:FROM 980256 GB:TO 980537 GB:DIRECTION - GB:GENE rpmA GB:PRODUCT LSU ribosomal protein L27P GB:NOTE COG0211 [J] Ribosomal protein L27 GB:PROTEIN_ID ABD99764.1 GB:DB_XREF GI:90821125 GB:GENE:GENE rpmA LENGTH 93 SQ:AASEQ MLMNLQFFAHKKGGGSTANGRDSQSKRLGAKSADGQVVTGGSILYRQRGTRIYPGVNVGMGGDNTLFAKVAGVVKFERKGRDKKQVSVYPVAE GT:EXON 1|1-93:0| BL:SWS:NREP 1 BL:SWS:REP 1->92|RL27_ENTFA|2e-44|88.0|92/95| PROS 41->55|PS00831|RIBOSOMAL_L27|PDOC00652| BL:PDB:NREP 1 BL:PDB:REP 9->92|2wdi0|9e-26|65.5|84/84| RP:PDB:NREP 1 RP:PDB:REP 9->92|3bboX|1e-26|54.8|84/86| RP:PFM:NREP 1 RP:PFM:REP 9->88|PF01016|7e-23|70.0|80/81|Ribosomal_L27| HM:PFM:NREP 1 HM:PFM:REP 9->89|PF01016|3.6e-38|60.5|81/81|Ribosomal_L27| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01016|IPR001684| GO:PFM GO:0005622|"GO:intracellular"|PF01016|IPR001684| GO:PFM GO:0005840|"GO:ribosome"|PF01016|IPR001684| GO:PFM GO:0006412|"GO:translation"|PF01016|IPR001684| RP:SCP:NREP 1 RP:SCP:REP 9->90|1vs6W1|6e-26|58.5|82/84|b.84.4.1| HM:SCP:REP 27->92|1v8qA_|4.8e-22|57.6|66/66|b.84.4.1|1/1|Ribosomal L27 protein| OP:NHOMO 1058 OP:NHOMOORG 1017 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-----1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 11--111-1-----11-111111111-111111111111111111111---------1-11111111111111111111111111111-12--1111-11--11-2-12--1-11-1----------1----------------1--------------------1---1---112222D33322343114211211-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 91 STR:RPRED 97.8 SQ:SECSTR ##EEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc DISOP:02AL 9-27,93-94| PSIPRED ccccEEEEEEEcccccccccccccccEEEEEEEccEEEccccEEEEccccEEEcccccccccccEEEEEEccEEEEEEEcccccEEEEEEccc //