[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : rpmB
DDBJ      :rpmB         LSU ribosomal protein L28P
Swiss-Prot:RL28_LACS1   RecName: Full=50S ribosomal protein L28;

Homologs  Archaea  0/68 : Bacteria  159/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.325.1
:61 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->60 2jz6A PDBj 4e-07 45.5 %
:RPS:PDB   3->55 3bboY PDBj 8e-10 32.1 %
:RPS:SCOP  3->61 2zjpU1  d.325.1.1 * 1e-11 25.4 %
:HMM:SCOP  1->61 2j0111 d.325.1.1 * 2.5e-17 42.6 %
:RPS:PFM   6->55 PF00830 * Ribosomal_L28 4e-05 50.0 %
:HMM:PFM   3->55 PF00830 * Ribosomal_L28 4.5e-22 49.1 53/61  
:BLT:SWISS 1->61 RL28_LACS1 6e-32 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99429.1 GT:GENE rpmB GT:PRODUCT LSU ribosomal protein L28P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(662644..662829) GB:FROM 662644 GB:TO 662829 GB:DIRECTION - GB:GENE rpmB GB:PRODUCT LSU ribosomal protein L28P GB:NOTE COG0227 [J] Ribosomal protein L28 GB:PROTEIN_ID ABD99429.1 GB:DB_XREF GI:90820790 GB:GENE:GENE rpmB LENGTH 61 SQ:AASEQ MAKDFVTGRKTTFGKKRSHALNQTNRSWKPNLQKVRILVDGKPKKVWVSTRALKSGKVTRV GT:EXON 1|1-61:0| SW:ID RL28_LACS1 SW:DE RecName: Full=50S ribosomal protein L28; SW:GN Name=rpmB; OrderedLocusNames=LSL_0619; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->61|RL28_LACS1|6e-32|100.0|61/61| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| BL:PDB:NREP 1 BL:PDB:REP 6->60|2jz6A|4e-07|45.5|55/77| RP:PDB:NREP 1 RP:PDB:REP 3->55|3bboY|8e-10|32.1|53/76| RP:PFM:NREP 1 RP:PFM:REP 6->55|PF00830|4e-05|50.0|50/61|Ribosomal_L28| HM:PFM:NREP 1 HM:PFM:REP 3->55|PF00830|4.5e-22|49.1|53/61|Ribosomal_L28| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00830|IPR001383| GO:PFM GO:0005622|"GO:intracellular"|PF00830|IPR001383| GO:PFM GO:0005840|"GO:ribosome"|PF00830|IPR001383| GO:PFM GO:0006412|"GO:translation"|PF00830|IPR001383| RP:SCP:NREP 1 RP:SCP:REP 3->61|2zjpU1|1e-11|25.4|59/72|d.325.1.1| HM:SCP:REP 1->61|2j0111|2.5e-17|42.6|61/0|d.325.1.1|1/1|L28p-like| OP:NHOMO 159 OP:NHOMOORG 159 OP:PATTERN -------------------------------------------------------------------- ----1---------------------------------------11--1-------------------1-------------1--111-------------------------------------------------------------------------------------------------------111111111111111111111111111111111111111111-1111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111--1-----------1---1-----1--1---1--11-1-1-1---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1-----------------------1-11-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 58 STR:RPRED 95.1 SQ:SECSTR ##cccccccTTccccccEEcccccccEEccccccccccccccccccccccccTTTccccc# DISOP:02AL 1-1| PSIPRED ccccEEccccccccccHHHHHHccccEEcccEEEEEEEEccEEEEEEEEHHHHHcccEEEc //